SecReT6
Protein ID: 261820390
SecReT6 ID368
T6SS typei1
Gene symbol-
Locus tagPecwa_1075
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T6SS(s) in this replicon]
Location [Strand]1163002..1164222 [+]
ProductFHA domain-containing protein
NoteFha
UniProt IDD0KJ48
KEGG IDpwa:Pecwa_1075
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 2.80E-05, Aligned region: 33..100
Protein Sequence: 406 a.a.     [Download]
>gi|261820390|ref|YP_003258496.1| FHA domain-containing protein [Pectobacterium wasabiae WPP163]
MNVTHPLTLVVLNSEQLDINSQVQHQFDHLGGTLGASEKDQWQLRDRLGSVLPAHARIEMTDGYFSLCDL
SGQSFINGSLSPIGRDRNVILSHGDELVIGPFRLGVYIGDPTTEQDIDQVLGLRTDDVLGGWLSEKKKGR
TAESADTAAVMNDPLWALQKEQSQPLLPSDSERGGESLTTSLSSFSAVEDTMDQKFVELPSINTPYAGEG
LEGYSDGTSLAPLMRGLGLSLQPGDDARLREMLEEMGKSLRAMVEGLLTLQTEQAALADTHLRPIEDNPL
RLGLGYADTLSVLFAEGKSPVHLSAPAAVEEVLNNVRVHHIANQQAIAAALENILQAFSPDALLSRFEHY
RRSGEPLAADDGWAWQMYQHYYRELTSPRQQGFQKLFHQVYAQAYDRAVRQQQEQK
 
Nucleotide Sequence: 1221 bp     [Download]
>gi|261819370|ref|NC_013421.1|:1163002-1164222 Pectobacterium wasabiae WPP163 chromosome, complete genome
GTGAACGTAACCCATCCACTCACGTTGGTTGTGCTCAACAGTGAGCAGCTCGATATCAATTCTCAGGTGC
AGCATCAGTTTGATCACCTCGGTGGCACGCTGGGTGCATCGGAAAAAGATCAGTGGCAGCTACGCGATCG
ATTGGGATCGGTGTTACCCGCGCATGCACGTATCGAAATGACCGATGGTTATTTCAGTCTATGCGATCTG
AGCGGGCAGTCTTTTATTAACGGTTCGCTGTCGCCGATTGGGCGGGATCGCAACGTCATTTTGTCGCACG
GCGATGAATTGGTGATTGGGCCTTTTCGGCTGGGCGTTTACATCGGCGATCCCACGACGGAACAGGATAT
CGATCAGGTGTTAGGGCTGCGCACGGACGATGTGTTAGGCGGCTGGTTAAGTGAAAAGAAAAAAGGGCGA
ACGGCAGAGAGTGCAGATACTGCGGCCGTGATGAATGACCCGCTGTGGGCGCTACAGAAAGAACAGAGCC
AGCCACTATTGCCATCAGACAGTGAGAGAGGCGGAGAATCGCTCACGACCTCTCTTTCTTCTTTTTCTGC
TGTTGAGGACACCATGGATCAGAAATTTGTCGAATTACCGAGCATCAATACCCCCTACGCGGGAGAAGGG
CTGGAAGGGTACAGCGACGGCACTTCGCTGGCTCCGTTGATGCGTGGCCTGGGGCTGTCGCTTCAGCCGG
GTGATGATGCTCGCCTGCGTGAAATGCTGGAAGAAATGGGGAAAAGCCTGCGTGCGATGGTTGAAGGGCT
GCTGACGTTGCAGACGGAACAGGCCGCACTGGCGGACACGCATTTACGCCCGATTGAAGATAACCCGCTG
CGTTTGGGGCTGGGCTATGCGGATACGCTGTCGGTGCTGTTTGCCGAAGGGAAAAGCCCGGTTCACCTGT
CTGCACCTGCTGCGGTGGAAGAAGTGTTGAACAATGTGCGGGTGCATCACATCGCGAATCAGCAAGCGAT
TGCTGCGGCGTTGGAAAATATTCTTCAGGCCTTTTCGCCAGACGCGCTGCTCAGCCGCTTTGAGCATTAT
CGCCGTAGTGGTGAACCACTGGCGGCGGATGACGGCTGGGCATGGCAAATGTATCAGCACTACTACCGAG
AATTGACGTCGCCACGTCAGCAAGGTTTCCAGAAACTGTTCCATCAGGTGTATGCGCAGGCGTATGACCG
TGCCGTGCGCCAACAGCAGGAGCAAAAATGA