SecReT6
Protein ID: 261820391
SecReT6 ID368
T6SS typei1
Gene symbol-
Locus tagPecwa_1076
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T6SS(s) in this replicon]
Location [Strand]1164219..1164743 [+]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDD0KJ49
KEGG IDpwa:Pecwa_1076
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.50E-37, Aligned region: 12..165
Protein Sequence: 174 a.a.     [Download]
>gi|261820391|ref|YP_003258497.1| type VI secretion lipoprotein [Pectobacterium wasabiae WPP163]
MMLRAFCLCSLMVVLSGCSTLSKMAQVAANPDIQVGSNNHQPSTVGFSLLAEPDVNPNESGEAAPIEFQL
VLLAEDSRLLATDYDQITTDIEKALAKNYLSHQDYTLLPGQFKYLPPEALDEKVHYLGVVARYADSESAE
WRKVIKLKNVGQTYQILVHLRRDEVEIKKDQEEE
 
Nucleotide Sequence: 525 bp     [Download]
>gi|261819370|ref|NC_013421.1|:1164219-1164743 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGATGCTGCGGGCATTTTGCTTATGTTCGCTGATGGTCGTGCTGTCGGGGTGTTCCACGCTGAGCAAGA
TGGCGCAGGTCGCGGCGAATCCTGATATCCAGGTGGGCAGCAACAATCATCAGCCTTCTACCGTGGGTTT
TAGCCTGCTGGCGGAACCGGACGTTAACCCGAATGAAAGTGGTGAAGCTGCACCTATCGAATTCCAACTG
GTCCTGCTGGCGGAAGATTCTCGCCTGTTAGCCACGGATTATGACCAGATCACGACGGATATCGAAAAGG
CGCTGGCCAAGAATTACCTCAGTCATCAGGACTACACGCTGTTGCCGGGGCAGTTCAAATACCTGCCGCC
AGAAGCGTTGGATGAAAAGGTGCACTACCTCGGCGTGGTCGCTCGCTATGCGGATTCGGAAAGTGCGGAA
TGGCGCAAGGTGATCAAGCTAAAAAATGTCGGGCAAACGTATCAGATCCTCGTGCACCTGCGCCGGGATG
AAGTCGAAATCAAAAAAGACCAAGAAGAAGAATAA