SecReT6
Protein ID: 261820392
SecReT6 ID368
T6SS typei1
Gene symbol-
Locus tagPecwa_1077
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T6SS(s) in this replicon]
Location [Strand]1164746..1166083 [+]
Producthypothetical protein
NoteTssK
UniProt IDD0KJ50
KEGG IDpwa:Pecwa_1077
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.90E-160, Aligned region: 19..443
Protein Sequence: 445 a.a.     [Download]
>gi|261820392|ref|YP_003258498.1| hypothetical protein Pecwa_1077 [Pectobacterium wasabiae WPP163]
MSSRNRIIWREGLFIKPQHFQQQQRHTDYALHARLSALSDYFYGLQSLEINEEYLNFGRIALVNASGVMP
DGTVFNIPGDDALPLPLEITDVALANQKVYLALPLAVNGVSEVGQPGQGIASRLQSHRHDVRDLHSDGGD
IVSLEVGKVSLRLMLDRDDRSAYASLAIANILDKRPDGGLILDPNFMPCSISVTAIPALKRFLGESAGLV
AERARSLAQRIAAPGQQGVADVAEFMMLQLLNRAQPRLSHLARLGTLHPERLHEALVELCGELMTFTDES
RLPPEFPAYRHEHQQASFEPLMMALRQALSTVLSPRAVSIQLKKQPYGVMVAMVGDAELMASAEFVLAVR
ARMPQEHLRKQLLQQTKIASSEKIRELISLQLPGIPLLPLPVAPRQLPYHAGYSYFQLDRQSPAWQVLVS
GNTLAFHIAGEFPELDMQLWAIRGQ
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|261819370|ref|NC_013421.1|:1164746-1166083 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGTCGAGTCGCAATCGCATTATCTGGCGGGAAGGTTTGTTCATTAAACCGCAGCATTTTCAACAGCAGC
AAAGACATACCGATTACGCATTGCATGCGCGTCTCAGCGCACTGAGTGATTATTTTTATGGCTTGCAATC
GCTGGAGATTAATGAGGAATACCTCAATTTTGGCCGCATCGCACTGGTTAATGCCAGCGGGGTGATGCCT
GATGGCACCGTGTTCAATATTCCGGGCGATGACGCCTTGCCGCTGCCGTTGGAGATCACCGACGTCGCGC
TGGCAAACCAGAAAGTGTATCTGGCACTACCGCTGGCGGTAAATGGCGTCAGCGAAGTGGGCCAACCGGG
ACAGGGGATCGCCAGCCGTTTGCAATCACACCGGCATGACGTGCGCGATCTGCATAGCGACGGCGGCGAT
ATCGTTTCTCTGGAGGTCGGCAAGGTTAGTCTGCGGTTGATGCTCGATCGTGACGATCGCAGCGCCTATG
CCTCGCTGGCGATTGCCAACATTCTGGATAAACGCCCTGACGGCGGCTTGATCCTGGATCCTAATTTTAT
GCCATGCAGCATCAGCGTTACGGCGATCCCTGCCTTAAAACGCTTCCTGGGGGAATCTGCCGGTCTGGTT
GCCGAACGTGCGCGCAGTCTGGCACAGCGTATTGCCGCACCGGGGCAACAGGGCGTGGCGGACGTAGCGG
AATTCATGATGCTGCAATTGCTTAACCGCGCCCAGCCCAGATTGTCGCATCTGGCCCGCCTTGGCACGCT
ACACCCCGAGCGCCTGCACGAGGCGTTAGTCGAGCTGTGTGGTGAACTGATGACGTTTACCGATGAGTCG
CGCCTGCCGCCTGAATTCCCGGCCTATCGTCATGAACATCAGCAGGCCAGCTTTGAGCCGCTGATGATGG
CGCTGCGTCAAGCCCTGAGCACCGTACTGTCACCGCGTGCCGTTTCCATCCAACTGAAGAAACAGCCGTA
TGGTGTGATGGTGGCGATGGTCGGCGATGCGGAATTGATGGCCAGCGCCGAGTTTGTACTGGCGGTGCGT
GCGCGTATGCCGCAGGAGCATCTGCGTAAACAACTGCTGCAACAAACGAAGATTGCCTCCAGCGAGAAGA
TCCGCGAACTGATCAGCCTACAACTGCCTGGCATTCCACTGCTGCCGCTGCCGGTTGCACCGCGTCAACT
GCCTTATCACGCGGGTTACAGCTATTTCCAACTGGATAGGCAAAGCCCCGCCTGGCAGGTGCTGGTATCT
GGCAATACGTTGGCGTTCCACATTGCTGGCGAGTTCCCGGAACTGGATATGCAGCTTTGGGCCATCCGCG
GTCAGTAG