SecReT6
Protein ID: 261820393
SecReT6 ID368
T6SS typei1
Gene symbol-
Locus tagPecwa_1078
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T6SS(s) in this replicon]
Location [Strand]1166099..1166875 [+]
ProductDotU family type IV / VI secretion system protein
NoteTssL
UniProt IDD0KJ51
KEGG IDpwa:Pecwa_1078
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.80E-70, Aligned region: 38..242
Protein Sequence: 258 a.a.     [Download]
>gi|261820393|ref|YP_003258499.1| DotU family type IV / VI secretion system protein [Pectobacterium wasabiae WPP163]
MSIEVIKNDQLGDLLFDHARQLDMDSDYWFRLRGQSINPMIDAVTPLLGMVERVRQLSAYEGVEDLYQRV
VSEVQAIEQELHSHSYENGVILSFRYILCTFIDEAVMGREWGGQSMWSAHSLLTRFHNETWGGEKVFVLL
EKLLDDPTRYRDILEFIYLCLCLGFEGRYRVMTQGREELDRVVSKLHDTLRPEPTNAPTVFHLNLGQQAS
RYQLRRQVSLRTLFIGVCVALVAAFGLYRYQLTHQTQDVLRQLGELLQ
 
Nucleotide Sequence: 777 bp     [Download]
>gi|261819370|ref|NC_013421.1|:1166099-1166875 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGAGCATCGAGGTTATTAAGAACGATCAATTGGGCGATCTGCTTTTTGACCACGCCCGACAGTTGGATA
TGGATTCCGACTACTGGTTCCGCCTGCGTGGACAAAGCATTAATCCGATGATTGATGCCGTTACGCCGTT
ATTGGGCATGGTGGAGCGGGTACGCCAGCTCTCTGCCTATGAGGGCGTGGAGGATCTCTATCAGCGCGTG
GTATCTGAAGTTCAGGCTATCGAACAGGAATTGCACTCTCATAGCTATGAGAACGGTGTGATCCTGTCTT
TCCGCTACATCCTCTGCACGTTTATTGATGAAGCCGTGATGGGGCGGGAGTGGGGTGGACAAAGCATGTG
GTCGGCACACTCTCTGCTGACTCGTTTTCATAATGAGACCTGGGGGGGCGAAAAGGTTTTCGTCCTGCTA
GAGAAGCTGTTGGACGATCCTACCCGCTATCGCGACATTCTGGAGTTTATCTACCTCTGCCTTTGTCTGG
GCTTTGAAGGGCGCTATCGGGTGATGACTCAAGGGCGTGAAGAGCTGGATCGCGTCGTGAGTAAGCTACA
TGACACCCTGCGCCCTGAGCCTACGAATGCGCCAACGGTATTCCACCTGAATCTGGGGCAGCAGGCCTCG
CGCTACCAACTGCGTAGGCAGGTGTCATTGCGCACGTTGTTTATCGGCGTGTGTGTAGCCTTGGTGGCCG
CATTCGGCCTGTACCGTTACCAGCTTACTCATCAGACCCAGGACGTACTGCGTCAACTGGGAGAATTATT
ACAATAA