SecReT6
Protein ID: 261820397
SecReT6 ID368
T6SS typei1
Gene symbol-
Locus tagPecwa_1082
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T6SS(s) in this replicon]
Location [Strand]1171599..1173026 [+]
Producttype VI secretion-associated protein
NoteTssA
UniProt IDD0KJ55
KEGG IDpwa:Pecwa_1082
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 6.70E-16, Aligned region: 49..109
Protein Sequence: 475 a.a.     [Download]
>gi|261820397|ref|YP_003258503.1| type VI secretion-associated protein [Pectobacterium wasabiae WPP163]
MHAHPWCKRLQTSLPDEKLRAAVLADDPLWEKVETELVKLGSLAHNQVDLNAVAGYCLTLLESKTKDMRV
LVQLLRCLQHPAKATPFSTALMLLDSWLESYWVTAWPASPVQKQKLMIQIVRRFEGALPRIAESASSAEL
EQLQQLTEQVATRWGELVSDKASLVDELVQGFKRARQRQQAQEKANQTANLTPAASSSGATGEGETRAGT
ASTPPVGSVEINSSDERGWRQTQLNVATLLVERHPDSPIGYRLRRHAIWSGIATPPMSAKGNKTQLAPVS
ADRVDEYQSALAQADLALWERIEQSLVLAPYWFDGHMLSASVASRLGHAPVATAIAEELSAFIQRLPELR
ELAFSDGAPFLTGKCSQWLQSSQPVRGGGGARQDDLATEAAACRDEKGIGAAMLLLDERMRRLKEPRDRF
YAELVLADLLAEEGMKSLAAQHYQHMWQESQQLGLMQWEPGMVSRVERLAASRKK
 
Nucleotide Sequence: 1428 bp     [Download]
>gi|261819370|ref|NC_013421.1|:1171599-1173026 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGCATGCACATCCCTGGTGTAAACGCCTGCAAACTTCGTTGCCGGATGAGAAGTTGCGCGCTGCGGTGT
TGGCCGACGATCCGCTTTGGGAAAAGGTAGAAACAGAGCTGGTCAAACTGGGATCGCTGGCGCACAACCA
GGTCGATCTTAATGCGGTGGCGGGTTATTGCCTGACGTTGCTGGAAAGCAAGACCAAAGACATGCGGGTA
TTGGTGCAGCTATTGCGCTGCTTACAGCACCCGGCTAAAGCGACGCCGTTTTCTACCGCGCTGATGTTGT
TGGACAGTTGGCTGGAGAGTTACTGGGTTACCGCCTGGCCTGCCAGTCCGGTTCAAAAACAAAAGTTGAT
GATCCAGATTGTTCGGCGTTTTGAGGGCGCGCTCCCGCGCATTGCAGAGAGCGCATCCAGTGCAGAGTTA
GAGCAATTACAGCAGTTAACTGAGCAAGTGGCGACCCGCTGGGGCGAACTGGTTAGCGACAAAGCCTCGC
TGGTGGATGAGTTGGTGCAGGGCTTTAAACGTGCCAGACAGCGGCAACAGGCACAAGAGAAGGCGAACCA
AACGGCAAATTTGACCCCGGCAGCGAGCAGCAGCGGTGCCACTGGGGAGGGTGAAACTCGCGCTGGTACA
GCCTCTACGCCGCCTGTCGGTTCCGTGGAAATTAATTCATCCGACGAGCGCGGATGGCGGCAAACCCAGT
TGAATGTTGCGACGCTGCTGGTTGAGCGTCATCCCGACTCACCGATCGGCTACCGCCTGCGACGTCATGC
TATCTGGTCCGGCATTGCGACTCCGCCGATGTCGGCCAAGGGGAATAAAACCCAATTGGCACCCGTCTCG
GCAGATCGTGTGGATGAATACCAAAGTGCGCTGGCACAGGCTGATTTGGCACTGTGGGAACGTATAGAAC
AAAGTCTGGTGCTGGCTCCTTATTGGTTTGATGGCCATATGTTGTCGGCCTCGGTGGCATCGCGGTTGGG
GCATGCTCCTGTTGCGACAGCCATTGCTGAAGAGCTTTCTGCATTTATTCAGCGTTTGCCGGAGTTGCGT
GAACTGGCATTCAGCGATGGTGCACCATTTTTGACAGGGAAGTGTAGCCAGTGGTTGCAGTCCAGCCAGC
CGGTGCGCGGTGGTGGCGGCGCGCGGCAGGACGATCTGGCGACGGAGGCGGCTGCCTGTCGGGATGAGAA
AGGCATCGGGGCGGCGATGTTGTTATTGGATGAGCGCATGCGTCGCCTGAAAGAGCCTCGCGACCGTTTT
TATGCCGAGCTGGTACTGGCGGATTTACTCGCCGAAGAAGGAATGAAATCACTGGCAGCACAGCACTATC
AGCACATGTGGCAGGAAAGCCAGCAATTGGGCCTGATGCAATGGGAACCGGGAATGGTCAGCCGCGTGGA
GCGGTTGGCGGCATCCCGCAAAAAATAA