SecReT6
Protein ID: 261820399
SecReT6 ID368
T6SS typei1
Gene symbol-
Locus tagPecwa_1084
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T6SS(s) in this replicon]
Location [Strand]1176722..1178158 [+]
ProductImpA domain-containing protein
NoteTssA
UniProt IDD0KJ57
KEGG IDpwa:Pecwa_1084
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 1.70E-39, Aligned region: 326..473
ImpA-rel_N [PF06812], Evalue: 1.10E-18, Aligned region: 39..98
Protein Sequence: 478 a.a.     [Download]
>gi|261820399|ref|YP_003258505.1| ImpA domain-containing protein [Pectobacterium wasabiae WPP163]
MQDAQQALKVGRDPRMLPEFDALRAEINKLSHASRPDVDWMLVHDMATTIFEKQGVDLQTAIYFTLARSR
LAGLTGFTESCEFLANLIVTQWDNFWPPVHQERARIEMLDWFIARISEVVRQYAISHEHKRLVYRCERAL
QLMSEKLHNTGLSRIPRVENLLHFVEGYTHLFDETEIVIVSDDQELKKQDMQIPPMVFFHSDMEPGATVQ
SGGSSGSGQAALPAGSILIGREKGQMKPTVLKIEAHKKQKPAWFWFVSGLLTCAVPVAAITGWQYWQEQK
ADALALLQQPAYALPTAPDHNDIRRVRIVLGEQKLQGMEGELINRYQAQLEQVKNASPFYLYQYGNGLKN
VMQQLYPDSLAVKEMERQWQIALERQQGDEPKTLGYEQARVRVNDTLQQLLELERQRRTVTISYLKSKLY
DMQKDLMSDVPFGIRLRELEARKIKSQSLTPAELRAMEDELRSFNIRLYRLQQGNSAS
 
Nucleotide Sequence: 1437 bp     [Download]
>gi|261819370|ref|NC_013421.1|:1176722-1178158 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGCAAGATGCACAACAGGCCCTGAAAGTTGGCCGAGATCCACGGATGCTGCCGGAGTTTGACGCACTTC
GGGCGGAAATTAACAAATTGAGTCATGCGTCTCGCCCTGATGTGGATTGGATGCTGGTGCACGATATGGC
CACCACCATCTTTGAAAAGCAGGGCGTGGATCTTCAGACCGCGATCTACTTTACCCTGGCGCGTTCACGC
TTGGCTGGCTTGACGGGCTTCACGGAAAGCTGTGAATTTTTGGCGAACCTGATCGTGACGCAGTGGGATA
ACTTCTGGCCACCGGTGCATCAGGAACGGGCGCGTATCGAGATGCTGGACTGGTTTATTGCCCGTATCAG
CGAAGTCGTGCGGCAGTACGCCATCAGCCATGAGCATAAGCGACTGGTTTATCGTTGCGAACGTGCACTG
CAACTGATGAGTGAAAAGCTGCACAACACGGGGTTAAGCCGTATTCCTCGCGTCGAGAATCTGCTGCACT
TCGTCGAAGGTTATACGCATCTGTTTGATGAAACGGAAATTGTCATTGTGTCGGACGATCAGGAATTGAA
AAAGCAGGATATGCAGATTCCCCCTATGGTGTTCTTTCATTCAGATATGGAGCCTGGGGCGACGGTACAG
AGCGGGGGTTCATCGGGTTCAGGCCAGGCTGCATTGCCTGCGGGCAGCATTCTCATCGGACGGGAGAAAG
GGCAAATGAAGCCGACGGTATTGAAAATTGAGGCGCATAAAAAACAGAAGCCAGCCTGGTTCTGGTTTGT
TTCCGGGCTGCTGACCTGTGCCGTACCGGTTGCGGCCATTACGGGATGGCAGTATTGGCAAGAGCAAAAA
GCCGATGCGTTGGCGCTACTGCAACAACCGGCGTATGCATTGCCCACGGCCCCTGACCATAATGACATTC
GCCGGGTGCGTATTGTTCTGGGTGAGCAGAAATTGCAGGGCATGGAAGGTGAGCTGATCAACCGCTATCA
GGCACAGTTGGAACAGGTAAAAAATGCGTCACCGTTCTACCTCTATCAATACGGTAATGGATTGAAAAAT
GTGATGCAGCAACTCTACCCCGATTCGCTGGCGGTGAAGGAGATGGAGCGCCAATGGCAGATTGCGCTTG
AACGTCAGCAGGGTGATGAGCCGAAAACGCTGGGTTACGAACAGGCGCGTGTCAGAGTCAACGATACCTT
GCAGCAACTGCTGGAACTGGAGCGTCAGCGCCGGACGGTGACGATTTCCTACCTGAAATCAAAACTCTAT
GATATGCAAAAAGACCTGATGTCAGATGTTCCTTTCGGGATACGGCTGCGGGAACTTGAAGCGCGTAAAA
TCAAGAGCCAATCGCTAACGCCAGCGGAGTTGCGTGCGATGGAGGACGAACTGCGCTCCTTCAATATTCG
TTTGTACCGTTTGCAGCAGGGTAATTCTGCCAGCTAA