SecReT6
Protein ID: 261821701
SecReT6 ID369
T6SS typei3
Gene symbol-
Locus tagPecwa_2439
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T6SS(s) in this replicon]
Location [Strand]2639273..2641411 [-]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDD0KEW1
KEGG IDpwa:Pecwa_2439
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.10E-74, Aligned region: 22..327
Phage_GPD [PF05954], Evalue: 1.10E-74, Aligned region: 532..532
Phage_base_V [PF04717], Evalue: 3.10E-25, Aligned region: 365..458
Gp5_C [PF06715], Evalue: 7.00E-17, Aligned region: 284..293
Gp5_C [PF06715], Evalue: 7.00E-17, Aligned region: 501..523
Gp5_C [PF06715], Evalue: 7.00E-17, Aligned region: 517..539
Gp5_C [PF06715], Evalue: 7.00E-17, Aligned region: 541..562
Gp5_C [PF06715], Evalue: 7.00E-17, Aligned region: 556..579
Gp5_C [PF06715], Evalue: 7.00E-17, Aligned region: 565..587
Gp5_C [PF06715], Evalue: 7.00E-17, Aligned region: 581..602
Protein Sequence: 712 a.a.     [Download]
>gi|261821701|ref|YP_003259807.1| ImpA family type VI secretion-associated protein [Pectobacterium wasabiae WPP163]
MFSRITAQLPMDGLLFWKLSGTETLSHSFVLTADLLATDARIDRHSLLGQPVTFTLPTQSLLSPRYLNGK
ITRVAVRSEELSGTRYAVYTLTVESDLWPMRRDRNLRIFQSQTVPQIVQTLLKEYGVNVEMRLSGSYRVW
EYCVQYQESSLDFLSRLMELEGIYYWFRHEQERHTLVLCDATDQHKAFPGYETMTYHVTPSGGSVTEEGI
SQWSLAESVTPGMYSTDDYDFRKPNAWMLQARQNPASPTPGSVDVYDWPGHFVDHSHGEFYTRIRQEVWQ
VEHHSVSGSGTVTGIAPGFTFGLLNAPHFSDNGEYLVTSATYVFEENSYASGDSGGSKHNIAFTVLPASV
TFRAPPTTAWPKTHGPQTAKVVGPQGESIWTDRYGRVKVKFHWDRLAKGDDTSSCWVRVSSAWAGQGFGG
VQIPRVGDEVVVDFINGDPDRPLIIGRVYNEASMPPWSLPAAATQMGFMSRSKDGTADTANALRFEDKSG
EEQVWLQAQKNMDTHVKNDETHSTDSNRTKTIGGNETTKVKKNRTETVDQNETLTIHQNRTETVDGNETI
TVHSNRTETVDQNESVRIGQNQSVSVNGNQTLKVAQAKTETIVLASMLNVGLAQNTNIGAAYVLNVGAGW
MTTVGAMHMHNVGRKYSLNVGRDIALSAGTSAEISAENKITLACGESKIVLEKNGTITLSANNIKLVGEK
VIDIDGTQIDIN
 
Nucleotide Sequence: 2139 bp     [Download]
>gi|261819370|ref|NC_013421.1|:c2641411-2639273 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGTTCTCACGCATCACCGCGCAGTTGCCGATGGACGGCCTGCTGTTCTGGAAACTCTCGGGCACCGAGA
CGTTGTCCCACTCATTTGTGCTGACCGCCGATCTGCTTGCCACCGACGCACGGATTGACCGACATTCGCT
GCTGGGCCAGCCGGTCACGTTCACACTGCCGACGCAGAGCCTGCTGAGCCCGCGTTACCTCAACGGCAAA
ATCACTCGGGTCGCGGTGCGCAGCGAAGAGCTGAGCGGCACGCGCTACGCGGTCTACACGCTGACGGTGG
AATCGGACCTGTGGCCGATGCGGCGTGACCGCAATCTGCGCATCTTCCAGAGTCAGACGGTGCCGCAGAT
AGTGCAGACGCTGCTGAAAGAGTACGGGGTGAATGTGGAGATGCGTTTATCGGGCAGCTACCGGGTGTGG
GAGTACTGCGTGCAGTATCAGGAGAGCAGCCTGGATTTCCTCAGCCGACTGATGGAGTTGGAGGGGATTT
ACTACTGGTTCCGCCACGAGCAGGAGCGCCACACGCTGGTGCTGTGCGACGCGACAGACCAGCACAAGGC
ATTTCCCGGCTACGAGACGATGACATATCACGTGACGCCGTCGGGTGGCAGCGTGACGGAAGAGGGCATC
AGCCAGTGGTCGCTGGCAGAGAGCGTCACGCCGGGAATGTACAGCACGGACGATTACGATTTTCGCAAGC
CAAACGCGTGGATGCTTCAGGCGCGGCAGAATCCGGCGTCGCCGACGCCGGGCTCGGTGGACGTGTACGA
CTGGCCGGGTCATTTTGTGGACCACAGCCACGGCGAGTTTTACACGCGTATCCGTCAGGAGGTGTGGCAG
GTAGAGCACCACAGCGTGAGCGGGTCGGGTACGGTGACGGGCATTGCACCGGGGTTTACCTTTGGTCTCC
TTAACGCGCCGCATTTTAGCGACAACGGTGAGTATCTGGTGACATCGGCGACGTATGTGTTTGAGGAAAA
CAGCTACGCCAGCGGTGATAGCGGAGGCTCGAAGCACAACATTGCGTTCACGGTGCTGCCCGCGTCGGTA
ACGTTCCGGGCGCCCCCGACGACGGCGTGGCCGAAGACGCACGGCCCGCAGACGGCGAAGGTGGTGGGCC
CGCAGGGAGAATCTATCTGGACGGACCGGTACGGCCGGGTGAAGGTAAAGTTCCACTGGGATCGACTGGC
GAAGGGCGACGACACCAGCTCGTGCTGGGTACGTGTATCGAGCGCCTGGGCGGGTCAGGGATTTGGCGGG
GTGCAGATCCCGCGCGTGGGCGATGAAGTGGTGGTGGACTTCATCAACGGCGACCCGGACCGCCCGCTGA
TCATCGGCCGGGTGTACAACGAGGCGAGCATGCCGCCGTGGTCGCTGCCAGCGGCAGCGACGCAGATGGG
ATTTATGAGTCGGTCGAAAGACGGCACGGCGGATACGGCGAACGCGCTGCGCTTTGAGGACAAGTCGGGT
GAGGAGCAGGTGTGGCTGCAAGCTCAGAAAAACATGGATACGCATGTCAAGAATGACGAAACCCACTCGA
CTGACAGCAATCGCACTAAAACCATTGGTGGCAATGAAACGACCAAGGTGAAAAAAAACCGCACCGAGAC
GGTTGATCAAAATGAGACCCTCACCATCCATCAGAACCGAACCGAAACCGTGGACGGCAATGAAACTATC
ACCGTGCACAGCAACCGCACGGAGACGGTCGATCAGAACGAAAGCGTGCGTATTGGTCAGAATCAGTCAG
TCAGCGTAAACGGTAATCAGACGCTGAAGGTGGCTCAGGCGAAAACTGAAACTATCGTGCTGGCTTCCAT
GCTTAATGTGGGACTGGCGCAAAATACCAATATCGGTGCGGCCTATGTGCTCAACGTGGGCGCGGGTTGG
ATGACTACCGTGGGGGCGATGCATATGCACAACGTCGGCAGGAAATACTCCCTGAATGTCGGGCGCGATA
TCGCGCTTTCTGCTGGCACGTCGGCCGAGATCAGCGCGGAAAACAAGATTACGCTGGCATGTGGCGAGTC
GAAGATTGTGCTGGAAAAGAATGGCACGATCACCCTCAGCGCGAACAACATCAAGCTGGTAGGTGAGAAG
GTGATCGACATTGACGGAACGCAGATAGATATCAATTGA