SecReT6
Protein ID: 261821709
SecReT6 ID369
T6SS typei3
Gene symbol-
Locus tagPecwa_2447
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T6SS(s) in this replicon]
Location [Strand]2647919..2650126 [-]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDD0KEW9
KEGG IDpwa:Pecwa_2447
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.50E-75, Aligned region: 22..327
Phage_base_V [PF04717], Evalue: 2.90E-25, Aligned region: 365..458
Phage_base_V [PF04717], Evalue: 2.90E-25, Aligned region: 607..624
Protein Sequence: 735 a.a.     [Download]
>gi|261821709|ref|YP_003259815.1| ImpA family type VI secretion-associated protein [Pectobacterium wasabiae WPP163]
MFSRITAQLPMDGLLFWKLSGTETLSHSFVLTADLLATDARIDRHSLLGQPVTFTLPTQSLLSPRYLNGK
ITRVAVRSEELSGTRYAVYTLTVESDLWPMRRDRNLRIFQSQTVPQIVQTLLKEYGVNVEMRLSGSYRVW
EYCVQYQESSLDFLSRLMELEGIYYWFRHEQERHTLVLCDATDQHKAFPGYETMTYHVTPSGGSVTEEGI
SQWSLAESVTPGMYSTDDYDFRKPNAWMLQARQNPASPTPGSVDVYDWPGHFVDHSHGEFYTRIRQEVWQ
VEHHSVSGSGTVTGIAPGFTFGLLNAPHFSDNGEYLVTSATYVFEENSYASGDSGGSKHNIAFTVLPASV
TFRAEPTTAWPKTHGPQTAKVVGPQGESIWTDRYGRVKVKFHWDRLAKGDDTSSCWVRVSSAWAGQGFGG
VQIPRVGDEVVVDFINGDPDRPLIIGRVYNEASMPPWNLPEDATRMGFMSRSKDGHHDNSSFLFFEDKSG
DELLNMHAEKDMSISVENDKTIAIEGCRTTTIGKEQSDKVTGDATFHYKQKRTTTVDDAEINTFNNGEFT
TIKNGRTLKITSGGDEISINGDKKTRIKGDEKRELSGSLNEGVEGDVVVNINGNWDQTVVSGKINIFSPN
EICIKSGKKVSIEAPSSWVKTALHSFSMTGFNESVTGNSVSFTGNSISGAGVSSSFTTVSNSLTALSNSS
ALVSYSIKTIDNRRSITKIEDSLQNLVISAIHLFI
 
Nucleotide Sequence: 2208 bp     [Download]
>gi|261819370|ref|NC_013421.1|:c2650126-2647919 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGTTCTCACGCATCACCGCGCAGTTGCCGATGGACGGCCTGCTGTTCTGGAAACTCTCGGGCACCGAGA
CGTTGTCCCACTCATTTGTGCTGACCGCCGACCTGCTTGCCACCGACGCACGGATTGACCGACATTCGCT
GCTGGGCCAGCCGGTCACGTTCACACTGCCGACGCAGAGCCTGCTGAGCCCGCGCTACCTCAACGGCAAA
ATCACTCGGGTCGCGGTGCGCAGCGAAGAGCTGAGCGGCACGCGCTACGCGGTCTACACGCTGACGGTGG
AATCGGACCTGTGGCCGATGCGGCGTGACCGCAATCTGCGCATCTTCCAGAGTCAGACGGTGCCGCAGAT
AGTGCAGACGCTGCTGAAAGAGTACGGGGTGAATGTGGAGATGCGTTTATCGGGCAGCTACCGGGTGTGG
GAGTACTGCGTGCAGTATCAGGAGAGCAGCCTGGATTTCCTCAGCCGACTGATGGAGTTGGAGGGGATTT
ACTACTGGTTCCGCCACGAGCAGGAGCGCCACACGCTGGTGCTGTGCGACGCGACAGACCAGCACAAGGC
ATTTCCCGGCTACGAGACGATGACATATCACGTGACGCCGTCGGGTGGCAGCGTGACGGAAGAGGGCATC
AGCCAGTGGTCGCTGGCAGAGAGCGTCACGCCGGGAATGTACAGCACGGACGATTACGATTTTCGCAAGC
CAAACGCGTGGATGCTTCAGGCGCGGCAGAATCCGGCGTCGCCGACGCCGGGCTCGGTGGACGTGTACGA
CTGGCCGGGTCATTTTGTGGACCACAGCCACGGCGAGTTTTACACGCGTATCCGTCAGGAGGTGTGGCAG
GTAGAGCACCACAGCGTGAGTGGGTCGGGTACGGTGACGGGCATTGCACCGGGGTTTACCTTTGGTCTCC
TTAACGCGCCGCATTTTAGCGACAACGGTGAGTATCTGGTGACATCGGCGACGTATGTGTTTGAGGAAAA
CAGCTACGCCAGCGGTGATAGCGGAGGCTCGAAGCACAACATTGCGTTCACGGTGCTGCCCGCGTCGGTA
ACGTTCCGGGCGGAGCCGACGACGGCGTGGCCGAAGACGCACGGCCCGCAGACGGCGAAGGTGGTGGGCC
CGCAGGGAGAGTCTATCTGGACGGACCGGTACGGCCGGGTGAAGGTAAAGTTCCACTGGGATCGACTGGC
GAAGGGCGACGACACCAGCTCGTGCTGGGTACGTGTATCGAGCGCCTGGGCGGGTCAGGGATTTGGCGGG
GTGCAGATCCCGCGCGTGGGCGATGAAGTAGTGGTGGACTTCATCAACGGCGACCCGGACCGCCCGCTGA
TCATCGGCCGGGTGTACAACGAGGCGAGCATGCCGCCGTGGAATCTCCCCGAGGATGCGACACGTATGGG
TTTTATGAGCCGCAGCAAAGACGGGCATCATGACAACTCCAGCTTCCTGTTTTTTGAGGATAAGTCGGGG
GATGAACTGCTCAATATGCATGCTGAGAAGGACATGAGCATCTCAGTGGAGAATGACAAGACCATCGCCA
TTGAAGGTTGTCGCACGACCACTATCGGCAAAGAACAGAGCGATAAAGTAACCGGTGATGCCACATTCCA
TTACAAGCAAAAGCGGACGACAACGGTTGATGATGCTGAGATTAATACATTTAATAATGGTGAATTTACA
ACTATAAAAAATGGACGTACTTTAAAAATAACAAGCGGTGGAGACGAAATATCAATTAATGGTGATAAAA
AAACTCGAATTAAAGGTGATGAAAAACGTGAACTTTCAGGTAGTTTAAACGAGGGAGTTGAAGGTGACGT
TGTTGTTAACATTAATGGTAACTGGGATCAGACCGTCGTGTCGGGAAAAATTAATATTTTTAGCCCTAAT
GAGATTTGTATTAAGAGTGGTAAAAAAGTAAGCATAGAAGCGCCTTCGAGTTGGGTGAAAACTGCGCTTC
ATTCTTTTTCAATGACTGGATTTAATGAAAGTGTTACTGGAAATAGTGTTTCATTTACTGGAAATAGTAT
CAGTGGGGCAGGAGTAAGTTCTTCGTTCACCACAGTCAGTAATAGCCTTACCGCCTTAAGTAACTCAAGT
GCGTTGGTTAGTTATTCGATAAAAACCATTGATAATAGACGCTCAATCACTAAAATTGAAGACTCTCTTC
AAAATTTAGTTATTAGTGCAATACATTTATTTATATGA