SecReT6
Protein ID: 261821711
SecReT6 ID369
T6SS typei3
Gene symbol-
Locus tagPecwa_2449
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T6SS(s) in this replicon]
Location [Strand]2651604..2654213 [-]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDD0KEX1
KEGG IDpwa:Pecwa_2449
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.80E-39, Aligned region: 222..241
AAA_2 [PF07724], Evalue: 1.80E-39, Aligned region: 600..765
AAA [PF00004], Evalue: 3.20E-20, Aligned region: 123..161
AAA [PF00004], Evalue: 3.20E-20, Aligned region: 224..356
AAA [PF00004], Evalue: 3.20E-20, Aligned region: 373..392
AAA [PF00004], Evalue: 3.20E-20, Aligned region: 606..690
ClpB_D2-small [PF10431], Evalue: 1.30E-15, Aligned region: 773..848
AAA_5 [PF07728], Evalue: 6.10E-12, Aligned region: 224..244
AAA_5 [PF07728], Evalue: 6.10E-12, Aligned region: 605..723
AAA_16 [PF13191], Evalue: 8.80E-10, Aligned region: 34..78
AAA_16 [PF13191], Evalue: 8.80E-10, Aligned region: 201..244
AAA_16 [PF13191], Evalue: 8.80E-10, Aligned region: 269..303
AAA_16 [PF13191], Evalue: 8.80E-10, Aligned region: 423..459
AAA_16 [PF13191], Evalue: 8.80E-10, Aligned region: 596..650
AAA_16 [PF13191], Evalue: 8.80E-10, Aligned region: 670..692
AAA_22 [PF13401], Evalue: 7.00E-08, Aligned region: 224..304
AAA_22 [PF13401], Evalue: 7.00E-08, Aligned region: 604..640
Sigma54_activat [PF00158], Evalue: 3.30E-07, Aligned region: 209..238
Sigma54_activat [PF00158], Evalue: 3.30E-07, Aligned region: 295..305
Sigma54_activat [PF00158], Evalue: 3.30E-07, Aligned region: 605..721
AAA_25 [PF13481], Evalue: 4.40E-06, Aligned region: 223..248
AAA_25 [PF13481], Evalue: 4.40E-06, Aligned region: 277..321
AAA_25 [PF13481], Evalue: 4.40E-06, Aligned region: 592..630
AAA_19 [PF13245], Evalue: 1.40E-05, Aligned region: 223..246
AAA_19 [PF13245], Evalue: 1.40E-05, Aligned region: 603..627
IstB_IS21 [PF01695], Evalue: 1.40E-05, Aligned region: 208..243
IstB_IS21 [PF01695], Evalue: 1.40E-05, Aligned region: 605..634
IstB_IS21 [PF01695], Evalue: 1.40E-05, Aligned region: 715..736
AAA_14 [PF13173], Evalue: 1.50E-05, Aligned region: 224..304
AAA_14 [PF13173], Evalue: 1.50E-05, Aligned region: 330..390
AAA_14 [PF13173], Evalue: 1.50E-05, Aligned region: 604..715
Zeta_toxin [PF06414], Evalue: 3.50E-05, Aligned region: 128..155
Zeta_toxin [PF06414], Evalue: 3.50E-05, Aligned region: 223..247
Zeta_toxin [PF06414], Evalue: 3.50E-05, Aligned region: 460..488
Zeta_toxin [PF06414], Evalue: 3.50E-05, Aligned region: 598..645
NACHT [PF05729], Evalue: 5.00E-05, Aligned region: 224..251
NACHT [PF05729], Evalue: 5.00E-05, Aligned region: 281..326
NACHT [PF05729], Evalue: 5.00E-05, Aligned region: 606..644
AAA_17 [PF13207], Evalue: 9.10E-05, Aligned region: 224..243
AAA_17 [PF13207], Evalue: 9.10E-05, Aligned region: 605..641
AAA_18 [PF13238], Evalue: 0.00029, Aligned region: 224..244
AAA_18 [PF13238], Evalue: 0.00029, Aligned region: 607..634
AAA_18 [PF13238], Evalue: 0.00029, Aligned region: 799..855
AAA_29 [PF13555], Evalue: 0.00066, Aligned region: 216..240
AAA_29 [PF13555], Evalue: 0.00066, Aligned region: 603..630
Arch_ATPase [PF01637], Evalue: 0.00093, Aligned region: 203..238
Arch_ATPase [PF01637], Evalue: 0.00093, Aligned region: 277..307
Arch_ATPase [PF01637], Evalue: 0.00093, Aligned region: 353..398
Arch_ATPase [PF01637], Evalue: 0.00093, Aligned region: 604..647
Clp_N [PF02861], Evalue: 0.0011, Aligned region: 28..75
Clp_N [PF02861], Evalue: 0.0011, Aligned region: 116..123
Clp_N [PF02861], Evalue: 0.0011, Aligned region: 311..321
RNA_helicase [PF00910], Evalue: 0.0022, Aligned region: 225..245
RNA_helicase [PF00910], Evalue: 0.0022, Aligned region: 606..627
RNA_helicase [PF00910], Evalue: 0.0022, Aligned region: 703..724
RuvB_N [PF05496], Evalue: 0.0058, Aligned region: 222..241
RuvB_N [PF05496], Evalue: 0.0058, Aligned region: 280..304
RuvB_N [PF05496], Evalue: 0.0058, Aligned region: 572..626
RuvB_N [PF05496], Evalue: 0.0058, Aligned region: 674..698
SRP54 [PF00448], Evalue: 0.007, Aligned region: 223..244
SRP54 [PF00448], Evalue: 0.007, Aligned region: 604..636
DUF258 [PF03193], Evalue: 0.0091, Aligned region: 213..242
DUF258 [PF03193], Evalue: 0.0091, Aligned region: 604..625
Protein Sequence: 869 a.a.     [Download]
>gi|261821711|ref|YP_003259817.1| type VI secretion ATPase, ClpV1 family [Pectobacterium wasabiae WPP163]
MSEISRAVLFGKLDTLLFTSLESATAFCKLRGNPYVELVHWLHQLMQQQEGDLQRVISHFSLDENALTRD
IVAALDRLPRGASAVSDLAEHIDSAVERAWVYASLKYGATRIRGGHLLIGMLKTFNLANVLKGISSQFAH
INADALLEQFDTVLGSSKEAQQALITPPGVDGAAPIASDSTLAQYAQDLTARAREGHIDPVTGRDEEIRQ
MVDILMRRRQNNPLLTGEAGVGKTAVVEGLALRIATGAVPAPLRDVQLWLLDIGILQAGAGMKGEFEARL
QALINEVQSSPTPIVLFVDEIHTLVGAGGQQGTGDAANLLKPALARGQLRTIGATTWAEYKKYIEKDPAL
TRRFQTVQIQEPDENKAILMLRGTVSALEKHHQVLLLDEAVSAAVKLSHRYIPARQLPDKAVALLDTACA
RVAVSQSAQPAALEDCLHRLDALEIEAEITSRETKVGLGDAGRQQAIAAQRTELEAERDALQQRWQKERE
LVNQLIALCGRCVVEGEAALRDELGIARQRLREIQSETPLLFAAVDAGVVAAVVSDWTGIPLGRMVKNEI
DAVLNLADTLNQRVIGQRHGLDLIAKRVRTARARLDNPNKPVGVFMLCGPSGVGKTETALALAESLYGGE
QNVITINMSEFQESHTVSTLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEIEKAHPDVHELFFQVFDK
GWMEDGEGRHIDFRNTIIILTSNVGTQVISALCADPELMPDPDSLSAALRKPLLEVFPAALLGRLLVVPY
YPLSDAMLAKIVQLQLARIVRRLADNHGIETEIDASVVHLIVQRCTEVESGGRMVDAILTNTLLPQMSQM
LLSAHARDEHYRRIYVRCEQGEFVCQFDI
 
Nucleotide Sequence: 2610 bp     [Download]
>gi|261819370|ref|NC_013421.1|:c2654213-2651604 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGTCAGAAATCAGCCGTGCCGTGTTATTCGGCAAGCTAGATACGTTGTTATTTACCTCGCTGGAAAGCG
CCACCGCCTTTTGTAAACTGCGCGGCAATCCCTATGTTGAACTGGTGCATTGGCTGCATCAGTTGATGCA
GCAACAAGAGGGTGACTTGCAGCGGGTCATCAGCCATTTTTCGCTGGATGAAAACGCACTGACGCGAGAT
ATCGTTGCTGCCCTTGACCGCCTGCCACGTGGAGCGAGTGCAGTCTCCGACCTCGCTGAACACATTGATA
GTGCTGTGGAGCGCGCCTGGGTTTACGCCTCGCTTAAGTATGGTGCCACACGGATCCGTGGTGGCCATCT
ACTGATCGGCATGCTGAAAACCTTCAATCTCGCCAACGTGCTGAAAGGCATTTCCAGCCAGTTTGCCCAT
ATTAACGCCGATGCGCTGTTGGAGCAGTTCGATACGGTACTCGGCAGCAGCAAAGAAGCGCAGCAGGCGC
TAATCACACCGCCGGGCGTAGACGGTGCCGCCCCGATAGCCAGCGATAGCACGCTGGCACAGTACGCACA
GGATCTCACCGCGCGGGCGCGTGAAGGGCATATTGATCCGGTCACCGGACGAGACGAAGAGATTCGCCAG
ATGGTGGATATTCTGATGCGTCGCCGCCAGAACAATCCGCTGCTGACCGGTGAGGCTGGCGTCGGTAAAA
CGGCGGTAGTAGAAGGACTGGCGCTACGGATTGCTACAGGCGCTGTGCCAGCACCGTTGCGCGATGTGCA
GTTGTGGCTGCTGGATATCGGCATACTACAAGCCGGTGCTGGGATGAAAGGTGAATTCGAAGCGCGTTTA
CAGGCACTAATCAATGAAGTGCAGTCCAGTCCAACGCCCATTGTGCTGTTTGTTGATGAGATCCACACGC
TGGTCGGCGCGGGTGGACAGCAGGGCACGGGCGATGCCGCTAACCTGCTTAAACCGGCGTTGGCGCGCGG
TCAGTTACGCACTATCGGCGCGACCACATGGGCTGAATACAAAAAATATATCGAGAAAGATCCTGCACTG
ACACGCCGCTTCCAGACTGTACAGATACAGGAACCGGATGAAAACAAAGCGATTCTGATGTTGCGCGGTA
CTGTTAGCGCACTGGAAAAGCATCATCAGGTGCTGCTGCTGGATGAAGCGGTCAGTGCGGCGGTGAAACT
GTCGCATCGCTATATTCCCGCACGGCAGTTGCCAGACAAAGCCGTTGCCCTGCTTGATACCGCTTGCGCG
CGGGTGGCGGTAAGCCAGAGCGCGCAGCCTGCGGCACTGGAAGATTGTTTACATCGCCTGGATGCACTGG
AAATTGAAGCAGAAATTACCTCGCGTGAAACCAAAGTCGGCCTTGGTGACGCTGGGCGGCAGCAGGCGAT
TGCCGCTCAGCGCACGGAACTGGAAGCCGAACGTGATGCGTTGCAGCAGCGTTGGCAGAAGGAACGCGAG
CTGGTTAATCAACTGATTGCGTTGTGTGGGCGTTGCGTGGTGGAAGGTGAAGCGGCATTGCGTGACGAAT
TGGGTATCGCTCGGCAGCGCTTGCGCGAGATACAGAGCGAAACACCGCTGCTGTTCGCGGCGGTTGATGC
TGGCGTGGTTGCGGCGGTTGTGTCTGACTGGACCGGCATTCCTCTGGGTCGCATGGTAAAGAACGAGATT
GATGCAGTACTCAACCTTGCTGACACCCTGAATCAACGCGTGATTGGTCAGCGTCACGGCCTGGATTTGA
TCGCCAAACGTGTGCGCACCGCGCGCGCGCGCCTCGACAACCCTAACAAACCGGTCGGCGTGTTTATGCT
GTGCGGTCCGTCGGGTGTCGGCAAAACGGAAACGGCGTTGGCTCTGGCGGAGTCACTGTATGGTGGTGAG
CAGAACGTCATCACCATCAACATGAGCGAATTTCAGGAATCGCACACCGTTTCCACGTTGAAAGGCGCGC
CTCCGGGCTACGTGGGTTACGGCGAGGGGGGTGTGCTGACCGAAGCCGTGCGTCGTCGTCCATACAGCGT
AGTCTTGCTGGATGAGATTGAGAAAGCGCATCCAGACGTACATGAACTTTTCTTTCAGGTGTTCGACAAA
GGCTGGATGGAGGATGGCGAAGGTCGGCATATCGATTTCCGTAACACCATCATCATTCTAACCTCCAATG
TCGGTACGCAGGTAATTAGTGCGTTGTGCGCCGATCCGGAACTGATGCCTGACCCAGATTCGCTCAGTGC
CGCGCTGCGTAAACCGTTGTTGGAGGTGTTCCCGGCCGCGCTGCTGGGGCGTTTATTGGTTGTGCCATAT
TACCCGCTGAGCGATGCCATGCTGGCGAAGATTGTGCAGTTACAACTGGCACGCATTGTTCGCCGTTTGG
CGGACAACCACGGCATTGAGACTGAGATCGATGCCTCCGTGGTACACCTGATCGTACAGCGCTGCACCGA
AGTTGAATCCGGTGGCCGTATGGTCGATGCCATCCTCACCAATACCCTGTTGCCGCAAATGAGCCAGATG
TTGCTCAGCGCCCATGCCCGCGATGAACACTATCGCCGTATATATGTACGCTGTGAACAGGGCGAATTTG
TTTGCCAATTCGATATCTAA