SecReT6
Protein ID: 261821713
SecReT6 ID369
T6SS typei3
Gene symbol-
Locus tagPecwa_2451
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T6SS(s) in this replicon]
Location [Strand]2655315..2657189 [-]
Producthypothetical protein
NoteTssF
UniProt IDD0KEX3
KEGG IDpwa:Pecwa_2451
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.70E-205, Aligned region: 5..624
Protein Sequence: 624 a.a.     [Download]
>gi|261821713|ref|YP_003259819.1| hypothetical protein Pecwa_2451 [Pectobacterium wasabiae WPP163]
MDSKLLDYYNRELAYLHEMGAEFAAHYPKVAGRLGMRGIDVADPYVERMLEGFAFLTSRVQLKMDAEFPR
FSQRMLEMIAPGYLSPTPSMAIAKLTPDTQKGDISNGFLVPRGTMMENQNLKKSGVTCSYTTAHDVMLQP
LCISDVSLGGVPADIPLGELKLSGLGAASALRIRIECEGVPSLDQLKLDDVILYLSGPDIQALKLLELLM
QHRVGILLQSVEEKPLRRVLSDDALQQEGFAPEQALLPDDLRNFDGYRLLQEYFAFPARFQFISLRQLAP
FIRCCGNARIFEIIILLDKADSALESVVDASHLALHCTPVINLFPKTAERLKISDSQHEYHLVVDNIRPL
DYEVHSVQRLFATVEGKREEQIFRSFWSTFSGDGSDYGAYFSLRREQRTLSEQAQRCGTRTGYIGSEVFL
SLVDEHHTPWRDDLRYLSADVMCTSRDLPLMLLQQDQGNFVMPDSIPVGPLTLCKGPTPPRPALAEGLSS
WRLISHLQMNYLSLMDCAGGEGAAALRQLLSLYANLADAPVSRQIEAIRHCQLSTVNRRVPEPGPVVFAR
GVSITLEVDEQAFSGASPWLFGSVLERVFSRLVALNSFTEFTLNSQQRGEVGYWPPRMGKKALI
 
Nucleotide Sequence: 1875 bp     [Download]
>gi|261819370|ref|NC_013421.1|:c2657189-2655315 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGGACAGCAAACTGCTCGATTACTACAACCGTGAGCTCGCTTATTTGCATGAAATGGGCGCGGAGTTTG
CCGCGCACTATCCCAAAGTGGCAGGGCGTCTGGGCATGCGAGGGATCGATGTCGCCGACCCTTACGTTGA
ACGAATGCTGGAAGGTTTTGCCTTCCTCACTTCGCGTGTTCAACTGAAAATGGACGCTGAATTTCCGCGT
TTTTCGCAGCGTATGCTGGAAATGATCGCGCCTGGTTACTTATCGCCAACGCCGTCAATGGCCATTGCCA
AACTGACGCCAGATACGCAAAAAGGCGACATCAGCAATGGTTTCCTCGTGCCACGCGGCACCATGATGGA
AAACCAAAATCTGAAAAAAAGCGGCGTCACCTGTAGCTACACCACGGCACATGACGTGATGCTGCAACCG
TTATGCATCAGCGATGTCTCGCTCGGCGGTGTACCGGCTGATATCCCTTTGGGTGAACTAAAACTGAGCG
GCCTCGGTGCCGCCAGTGCATTGCGGATCCGTATTGAATGTGAAGGTGTTCCGTCGTTAGACCAGCTTAA
GCTGGATGATGTAATACTGTACCTGAGTGGCCCGGATATCCAGGCGCTGAAGCTGTTGGAATTATTGATG
CAGCATCGTGTCGGCATCCTGTTGCAATCCGTGGAAGAAAAGCCGCTGCGCCGGGTGTTAAGCGATGATG
CGCTACAGCAGGAAGGGTTTGCACCAGAGCAGGCGCTGCTGCCAGACGACCTGCGTAACTTCGATGGCTA
TCGCCTGTTGCAGGAGTATTTTGCTTTTCCTGCCCGTTTCCAGTTCATCAGTTTAAGGCAGTTAGCGCCG
TTCATTCGCTGCTGTGGCAACGCCCGAATCTTTGAAATTATTATCTTGCTGGATAAAGCCGACAGCGCAC
TAGAGAGTGTGGTGGATGCCAGTCATCTGGCATTACATTGCACCCCCGTCATTAATCTGTTCCCGAAAAC
CGCTGAACGTTTAAAGATCAGCGACAGCCAACACGAGTACCACTTGGTGGTCGATAATATCCGTCCACTG
GATTATGAAGTGCATTCGGTTCAGCGACTATTTGCCACGGTGGAAGGGAAACGAGAGGAGCAGATTTTCC
GCTCTTTCTGGAGCACCTTCAGTGGCGATGGCAGCGATTACGGTGCCTATTTTTCGCTGCGGCGCGAGCA
GCGCACGCTGTCCGAACAGGCGCAGCGCTGTGGCACACGCACTGGCTACATCGGTTCGGAAGTTTTCCTG
TCGCTGGTCGATGAGCACCATACGCCGTGGCGTGATGACCTGCGTTATCTATCGGCAGACGTGATGTGTA
CCAGTCGTGATTTACCACTCATGCTATTACAGCAGGATCAGGGCAACTTCGTGATGCCAGATTCGATCCC
GGTGGGGCCGTTGACGTTGTGCAAAGGCCCAACGCCACCGCGTCCGGCGCTAGCAGAAGGCCTCTCATCC
TGGCGGCTGATTAGCCATCTGCAAATGAATTACCTCAGTCTGATGGACTGCGCCGGCGGTGAAGGCGCTG
CAGCATTGCGCCAACTACTTAGCCTGTACGCCAACTTAGCCGATGCGCCAGTGTCACGCCAAATAGAAGC
CATCCGCCATTGCCAGCTCAGCACCGTCAACCGCCGTGTACCTGAACCGGGGCCCGTAGTGTTTGCACGG
GGTGTCAGCATCACGCTGGAGGTCGATGAACAGGCGTTTTCCGGTGCAAGCCCGTGGCTATTTGGCAGCG
TCTTGGAACGCGTTTTCTCTCGACTGGTTGCGCTAAACAGTTTCACTGAATTCACTCTGAACAGTCAGCA
GCGTGGCGAAGTCGGTTACTGGCCGCCTCGCATGGGCAAGAAGGCGTTGATATGA