SecReT6
Protein ID: 261821714
SecReT6 ID369
T6SS typei3
Gene symbol-
Locus tagPecwa_2452
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T6SS(s) in this replicon]
Location [Strand]2657192..2657767 [-]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDD0KEX4
KEGG IDpwa:Pecwa_2452
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 8.50E-20, Aligned region: 60..170
Protein Sequence: 191 a.a.     [Download]
>gi|261821714|ref|YP_003259820.1| type VI secretion system lysozyme-like protein [Pectobacterium wasabiae WPP163]
MSSDNRSHNDGHAQLYGGFRARKNRDALTARDKLQSSLLDRLTDNAPDKRNEASSNTLISHSALRRHVLR
DLQWLFNTINNEAQQDLSEFGEVQRSVWNFGVAPLSGQNISDIEWQDIQRKMTDAILHFEPRILPQGLQV
RCVSDMTSLSLHNVLSIEIKGRLWCVPYPLEFLFRTQIELESGHFELQDAG
 
Nucleotide Sequence: 576 bp     [Download]
>gi|261819370|ref|NC_013421.1|:c2657767-2657192 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGAGCAGTGATAACCGCTCGCACAACGACGGTCATGCGCAGTTGTATGGCGGTTTCCGCGCACGTAAAA
ATCGCGATGCGTTAACCGCGCGCGACAAGCTGCAATCGTCGCTGCTCGATCGCCTGACCGATAATGCGCC
GGACAAACGTAACGAAGCCAGCAGCAACACGTTGATCTCGCACAGCGCACTGCGTCGGCATGTGCTGCGA
GACCTGCAGTGGCTGTTCAACACCATCAACAATGAGGCGCAGCAGGATCTCAGCGAATTCGGCGAAGTGC
AGCGTTCGGTGTGGAATTTCGGTGTGGCACCGCTGTCCGGGCAGAACATCTCAGACATCGAATGGCAGGA
TATACAGCGCAAAATGACTGATGCCATCCTGCACTTTGAGCCGCGCATTCTGCCGCAGGGCTTGCAGGTG
CGCTGCGTCAGCGACATGACATCACTCAGCCTGCATAACGTGTTGTCGATTGAGATTAAGGGCCGCCTGT
GGTGCGTGCCTTATCCATTGGAGTTTTTGTTCCGTACCCAGATTGAGCTGGAGAGCGGTCATTTCGAACT
ACAGGATGCCGGTTAA