SecReT6
Protein ID: 261821715
SecReT6 ID369
T6SS typei3
Gene symbol-
Locus tagPecwa_2453
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T6SS(s) in this replicon]
Location [Strand]2657757..2658584 [-]
Productvirulence protein SciE type
NoteTagJ
UniProt IDD0KEX5
KEGG IDpwa:Pecwa_2453
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 7.10E-39, Aligned region: 143..266
Protein Sequence: 275 a.a.     [Download]
>gi|261821715|ref|YP_003259821.1| virulence protein SciE type [Pectobacterium wasabiae WPP163]
MESLQQRLTRGSLADNLAEIMRQIQAAPANADLRAAFVQLLCLAGNWTRAQTQLQSWLALTPLAQPTVTL
LQQAIAGEQQREAVLRGEVEPQLPGCAWRWCETLLAALRADITGDYVRGAEWRAEALDQADANPGQLQQQ
DETTNFAWLMDGDSRFGPVCEAITNGRYYWIPFAAIREMVFQAPTSVTDLIWRHTRVQLVDGSEQICQIP
VRYPLQQGTDERYLRASVTEWQTLGKEGGQFIGNGQKVWLSDSAEFPLLTLQQITFNAIEADDEQ
 
Nucleotide Sequence: 828 bp     [Download]
>gi|261819370|ref|NC_013421.1|:c2658584-2657757 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGGAGTCGTTACAACAGCGTCTGACGAGAGGTTCATTGGCCGATAATCTTGCTGAGATCATGCGCCAGA
TTCAGGCCGCCCCGGCCAATGCCGATTTACGAGCCGCCTTTGTGCAACTGCTGTGTTTGGCTGGCAATTG
GACGCGCGCGCAAACTCAACTGCAATCTTGGCTAGCCTTAACGCCACTGGCGCAGCCCACGGTAACCTTA
CTACAGCAGGCAATTGCCGGTGAACAGCAGCGTGAAGCGGTGCTGCGCGGCGAGGTGGAGCCGCAGTTGC
CGGGCTGCGCCTGGCGCTGGTGTGAAACCCTGCTGGCTGCACTGCGTGCTGATATCACCGGTGATTACGT
GCGCGGTGCTGAGTGGCGTGCCGAGGCGCTGGATCAGGCTGACGCCAATCCTGGTCAACTGCAACAGCAG
GATGAGACAACGAATTTCGCTTGGCTGATGGACGGCGACAGCCGTTTTGGTCCGGTATGCGAAGCCATCA
CCAACGGTCGTTATTACTGGATCCCGTTTGCCGCTATTCGCGAGATGGTGTTTCAGGCTCCAACCAGCGT
CACCGACCTCATTTGGCGTCACACCCGCGTACAACTGGTGGATGGCAGCGAACAGATTTGCCAGATCCCA
GTGCGTTACCCCTTGCAGCAAGGTACGGATGAGCGCTATCTGCGCGCCAGCGTTACCGAATGGCAGACGC
TGGGCAAAGAGGGTGGCCAGTTCATCGGCAACGGTCAGAAAGTGTGGCTGAGCGACAGTGCTGAATTCCC
GCTGCTGACGCTGCAACAGATCACCTTTAACGCGATCGAGGCTGACGATGAGCAGTGA