SecReT6
Protein ID: 261821718
SecReT6 ID369
T6SS typei3
Gene symbol-
Locus tagPecwa_2456
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T6SS(s) in this replicon]
Location [Strand]2660377..2662191 [-]
ProductFHA domain-containing protein
NoteFha
UniProt IDD0KEX8
KEGG IDpwa:Pecwa_2456
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 6.40E-08, Aligned region: 27..95
UreE_N [PF02814], Evalue: 0.0038, Aligned region: 32..49
UreE_N [PF02814], Evalue: 0.0038, Aligned region: 78..99
UreE_N [PF02814], Evalue: 0.0038, Aligned region: 422..435
Protein Sequence: 604 a.a.     [Download]
>gi|261821718|ref|YP_003259824.1| FHA domain-containing protein [Pectobacterium wasabiae WPP163]
MRFTIVTTKPGHQPPQIRCDFLPPGGTIGRGVDNNLVLPDDDRTISRLQAIVHITATGECRLTNRGNVTR
VQLNDIPLERGRQVELQDGDVLGIGDYQLLVNDFNNAPQSQAALIEPLPAVKPIIIADEPSAEKTSNTAT
IPSEIWDSLTKEFSISDDLSKRKNTMPEQPMAHPLTAPAGVERNPEDPLAQLLSDTPLNIGQQPQNTSLF
DEADALFAQESIFDDRTPSTLSAQQNAAAQPQVETISTEIEPLSLFGSQSATDARSHDDPLGLMMGNAVP
LAQPEILVAKPEQPEPIAEAQPGSVPVELADLCSSPLFDNIDTQATSESLSSNEPELKQSDTANSPIDYG
GITLPTPQAVQRTPLPTPKGRLRIDPVASGSQASAPTASSIASQSSGERLKGELLDALLEGMGLRDLQPT
PQLDREQMLQFGQMLSMFSQGTVALLSSRSILKRGVKADMTMILDDANNPFKLLPSGKTVLMQMFGSRMP
GFMPPRQAVRDALIDLQAHQLGMIAGIRAIIASMLQSFNPDQLEEEARQAGAVSRLGLPGSRKAALWEHF
VERYGETAGEIEDDFHTLFGEAFLHAYDLEVNQYKDSQTHTDAT
 
Nucleotide Sequence: 1815 bp     [Download]
>gi|261819370|ref|NC_013421.1|:c2662191-2660377 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGCGCTTTACGATAGTAACGACTAAACCTGGCCACCAGCCACCGCAAATCCGTTGTGACTTCCTTCCGC
CCGGTGGCACCATTGGTCGTGGGGTTGATAACAATCTGGTATTACCCGATGACGATCGCACTATCTCTCG
CCTGCAGGCGATTGTGCACATCACTGCGACGGGTGAATGCCGCCTGACCAACCGTGGCAACGTGACGCGT
GTACAGCTCAACGATATTCCGCTGGAACGGGGTCGTCAGGTTGAATTACAGGATGGCGATGTGCTGGGTA
TTGGTGATTACCAACTGTTAGTCAACGATTTCAATAACGCGCCGCAGTCGCAGGCTGCACTCATCGAGCC
ACTTCCTGCGGTCAAACCTATTATTATCGCCGATGAACCATCAGCGGAAAAAACCAGCAACACGGCGACG
ATCCCCAGTGAAATCTGGGATAGCCTCACCAAAGAATTTTCGATCTCTGATGATTTGTCGAAGCGTAAGA
ACACCATGCCTGAGCAGCCGATGGCGCATCCGTTGACAGCGCCTGCAGGTGTTGAACGCAACCCGGAAGA
TCCTTTAGCACAGTTACTCAGCGATACGCCGCTGAATATCGGACAACAACCGCAAAACACCAGTCTATTC
GATGAAGCTGATGCGCTTTTTGCTCAGGAAAGCATCTTTGACGACCGTACACCGAGCACACTCTCCGCGC
AGCAAAATGCGGCAGCGCAGCCGCAGGTGGAAACCATCTCAACCGAGATCGAACCACTGAGCCTGTTCGG
TAGCCAGAGCGCTACAGATGCGCGCAGTCACGACGATCCGCTCGGTCTGATGATGGGCAATGCGGTGCCG
CTGGCACAGCCCGAGATTCTGGTTGCTAAGCCTGAACAGCCGGAACCTATCGCCGAAGCGCAGCCTGGAA
GCGTACCGGTTGAACTCGCGGATCTCTGTAGCTCACCGCTGTTTGATAACATCGACACACAAGCCACCAG
CGAATCGCTGTCGAGCAATGAACCTGAGTTGAAGCAGTCTGACACAGCCAATTCGCCAATCGATTATGGC
GGTATCACGCTGCCGACGCCGCAGGCGGTACAGCGCACGCCATTGCCAACGCCGAAAGGGCGCTTGCGTA
TCGACCCGGTAGCCTCTGGCAGCCAGGCCAGTGCGCCTACAGCGAGCAGCATAGCCAGCCAAAGCAGCGG
CGAACGGCTGAAAGGCGAACTGCTGGATGCACTGCTGGAAGGCATGGGTCTGCGCGATCTGCAGCCGACG
CCACAGTTAGACCGTGAGCAGATGTTGCAGTTTGGTCAGATGCTCAGCATGTTCTCGCAGGGCACGGTGG
CGCTGCTGTCGTCGCGTTCGATCCTCAAACGCGGCGTAAAAGCAGATATGACGATGATCCTCGATGACGC
CAACAACCCATTTAAGCTACTGCCTTCCGGCAAAACCGTATTGATGCAGATGTTTGGCAGTCGTATGCCA
GGCTTTATGCCACCGCGTCAGGCGGTACGTGATGCGCTGATCGATCTACAGGCACACCAGTTGGGGATGA
TTGCCGGGATCCGCGCCATCATCGCCTCAATGTTGCAATCCTTTAATCCGGACCAGCTAGAAGAAGAAGC
GCGTCAGGCGGGCGCAGTCTCACGTCTGGGTTTACCCGGTAGCCGTAAAGCGGCGCTGTGGGAGCATTTT
GTGGAGCGCTACGGCGAGACGGCAGGCGAGATCGAAGACGATTTTCACACCCTGTTTGGTGAAGCGTTCC
TGCATGCCTATGACCTGGAAGTTAATCAGTACAAAGACTCACAAACCCACACGGATGCCACATGA