SecReT6
Protein ID: 261821721
SecReT6 ID369
T6SS typei3
Gene symbol-
Locus tagPecwa_2459
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T6SS(s) in this replicon]
Location [Strand]2663628..2664110 [-]
Producthypothetical protein
NoteTssD
UniProt IDD0KEY1
KEGG IDpwa:Pecwa_2459
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.10E-36, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|261821721|ref|YP_003259827.1| hypothetical protein Pecwa_2459 [Pectobacterium wasabiae WPP163]
MAIDMFLKVDGVTGESKDANHTGWTDINSFYWGANQPGNMSVGGGGGAGKVNFVDLSVNALIDKSTTAIL
KYCASGKHLSKIELSVCKAGGQQVEYARITLEDVLVTSVNYTGSDSGDTVGITYAFQASKVKQQYWEQTS
SGSKGAESSAGWNIKENKEA
 
Nucleotide Sequence: 483 bp     [Download]
>gi|261819370|ref|NC_013421.1|:c2664110-2663628 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGGCTATTGATATGTTTTTAAAAGTTGATGGTGTGACGGGTGAGTCTAAAGACGCTAACCACACCGGCT
GGACGGATATCAATTCCTTTTACTGGGGCGCTAACCAACCTGGTAATATGTCCGTAGGTGGTGGCGGCGG
GGCCGGTAAGGTTAATTTTGTCGACCTGAGTGTCAATGCGTTGATCGACAAATCAACTACCGCAATCCTT
AAATATTGCGCAAGTGGTAAGCACCTTTCCAAAATTGAACTTTCGGTTTGTAAAGCGGGCGGTCAACAAG
TGGAATATGCTCGTATCACTTTAGAAGATGTGCTCGTGACTTCCGTTAACTACACTGGCTCTGACAGTGG
TGATACTGTTGGCATTACCTATGCCTTCCAGGCCTCAAAAGTGAAACAGCAGTACTGGGAACAAACTTCA
TCCGGCAGTAAAGGTGCTGAAAGCAGTGCGGGATGGAATATCAAAGAGAATAAAGAGGCGTAA