SecReT6
Protein ID: 261821722
SecReT6 ID369
T6SS typei3
Gene symbol-
Locus tagPecwa_2460
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T6SS(s) in this replicon]
Location [Strand]2664419..2665918 [-]
Producthypothetical protein
NoteTssC
UniProt IDD0KEY2
KEGG IDpwa:Pecwa_2460
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.60E-197, Aligned region: 66..492
Protein Sequence: 499 a.a.     [Download]
>gi|261821722|ref|YP_003259828.1| hypothetical protein Pecwa_2460 [Pectobacterium wasabiae WPP163]
MTQTSQPQQPQGETRFSQDEFSALLNKEFRPKSDQAREAVERAVKTLAQQALENAITVSSDAYRTIQALI
AEIDEKLSQQVNQIIHHDDFQTLESAWRGLNYLVNNTETDEMLKIRFMSISKKELGRSLKRFKGAGWDQS
PLFKKIYEQEYGQFGGEPFGCLVGDYYFDHSPQDVELLGEMARIGAAAHCPFITGTAPGVMQMESWQELA
NPRDLTKIFQNTEYAAWRSLRESEDARYLGMMMPRFLARLPYGIRTNPVDNFDFEEQTDGSDHSNYAWSN
AAYAMAANINRSFKEYGWCTAIRGVESGGAVENLPCHTFPSDDGGVDMKCPTEIAISDRREAELAKNGFM
PLVHRKNSDFAAFIGAQSLQKPTEYHDADASANARLAARLPYLFACCRFAHYLKCIVRDKIGSFRERDEM
ERWLNDWVMNYVDGDPANSSQETKSRKPLAAAEVTVEEQEDNPGYYAAKFFLRPHYQLEGLTVSLRLVSK
LPSLKSNEN
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|261819370|ref|NC_013421.1|:c2665918-2664419 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGACCCAGACTTCACAACCGCAGCAACCGCAGGGCGAAACCCGTTTTAGTCAGGATGAGTTCAGCGCGC
TGCTGAACAAAGAGTTCCGTCCGAAGAGCGATCAGGCGCGTGAAGCAGTAGAGCGCGCGGTGAAAACGTT
GGCGCAGCAGGCATTGGAAAATGCCATTACCGTATCGAGTGATGCGTACCGCACCATTCAGGCGCTGATC
GCTGAGATCGATGAAAAGCTGTCGCAGCAGGTGAATCAGATCATTCACCACGATGATTTTCAGACGCTGG
AAAGCGCGTGGCGCGGTCTGAATTATCTGGTGAACAACACCGAAACTGACGAGATGCTGAAAATTCGTTT
CATGAGCATCTCCAAGAAGGAGTTGGGCCGTAGCCTGAAACGTTTCAAAGGGGCGGGGTGGGATCAAAGC
CCGCTGTTCAAAAAAATCTACGAGCAGGAGTATGGTCAGTTCGGTGGTGAACCGTTTGGCTGTCTGGTGG
GCGATTATTACTTCGACCACAGCCCACAGGATGTCGAACTGCTGGGTGAAATGGCACGCATCGGTGCGGC
CGCACACTGTCCGTTCATCACCGGTACTGCACCGGGTGTGATGCAGATGGAATCCTGGCAGGAGCTGGCT
AACCCACGCGATCTGACCAAGATTTTCCAAAACACCGAATATGCTGCATGGCGTAGCCTGCGTGAATCGG
AAGATGCCCGCTACCTCGGTATGATGATGCCGCGTTTCCTCGCGCGTCTGCCTTACGGTATTCGCACCAA
TCCGGTTGATAACTTTGATTTTGAAGAGCAGACCGACGGCTCTGACCACAGCAATTATGCATGGAGCAAT
GCGGCTTACGCGATGGCAGCCAACATCAACCGCTCGTTTAAAGAATACGGCTGGTGTACCGCGATTCGCG
GCGTGGAATCGGGTGGCGCAGTCGAAAACCTGCCGTGCCACACTTTCCCAAGTGATGACGGTGGCGTGGA
TATGAAGTGTCCGACCGAAATCGCCATCAGCGACAGACGCGAAGCCGAGTTGGCGAAAAACGGCTTTATG
CCGCTGGTGCATCGTAAAAACTCTGACTTTGCCGCCTTTATCGGTGCACAGTCGCTGCAGAAGCCAACCG
AGTATCACGATGCTGATGCCAGCGCCAACGCCCGCCTGGCCGCCCGTTTGCCCTATCTGTTCGCCTGCTG
CCGCTTCGCGCATTACCTGAAATGCATTGTGCGCGATAAGATCGGTTCTTTCCGCGAGCGTGATGAAATG
GAGCGCTGGTTGAACGATTGGGTAATGAACTACGTTGATGGCGATCCTGCTAACTCCTCGCAGGAAACCA
AATCGCGTAAACCACTGGCCGCAGCCGAGGTAACCGTAGAGGAGCAGGAAGATAATCCAGGCTATTACGC
AGCGAAATTCTTCCTGCGCCCGCATTACCAGCTAGAAGGCCTGACGGTTTCGCTGCGCCTAGTATCGAAA
CTGCCATCGCTGAAATCGAATGAAAATTGA