SecReT6
Protein ID: 261821723
SecReT6 ID369
T6SS typei3
Gene symbol-
Locus tagPecwa_2461
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T6SS(s) in this replicon]
Location [Strand]2665918..2666448 [-]
Producthypothetical protein
NoteTssB
UniProt IDD0KEY3
KEGG IDpwa:Pecwa_2461
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.40E-59, Aligned region: 12..163
Protein Sequence: 176 a.a.     [Download]
>gi|261821723|ref|YP_003259829.1| hypothetical protein Pecwa_2461 [Pectobacterium wasabiae WPP163]
MASTKSSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVLADLVGKPLEPQVALDERKFLEIDIDN
FDERMKALKPRAAFQVDNTLNGEGKLNIDLTFESMDDFSPDAIARNVEPLSKLLDARTQLANLLTYMDGK
NGAEELVGKILQDPTLLQALTHLPKQDDAAEGKEDQ
 
Nucleotide Sequence: 531 bp     [Download]
>gi|261819370|ref|NC_013421.1|:c2666448-2665918 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGGCATCAACGAAATCCAGTGGGCAAAAGTTCATTGCCCGCAATCGCGCACCTCGCGTTCAGATCGAAT
ATGACGTGGAAATTTATGGCGCGGAACGCAAAATTCAGTTGCCGTTCGTCATGGGGGTATTGGCGGATCT
GGTGGGCAAACCGCTGGAGCCGCAGGTGGCCCTCGATGAACGTAAATTCCTCGAAATCGACATCGATAAC
TTTGATGAGCGCATGAAAGCGTTGAAGCCGCGCGCTGCCTTTCAGGTGGATAACACGTTGAACGGCGAAG
GTAAATTGAACATCGACCTGACTTTCGAAAGCATGGACGACTTCTCGCCTGACGCCATCGCGCGCAACGT
TGAGCCGCTGAGCAAGCTGTTGGATGCACGTACCCAGTTGGCTAACCTACTGACCTATATGGACGGTAAA
AACGGTGCGGAAGAACTGGTCGGTAAAATTTTGCAAGACCCCACGCTGCTGCAGGCGTTGACGCATCTGC
CGAAGCAGGACGATGCCGCTGAAGGTAAGGAAGATCAATAA