SecReT6
Protein ID: 261821724
SecReT6 ID369
T6SS typei3
Gene symbol-
Locus tagPecwa_2462
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T6SS(s) in this replicon]
Location [Strand]2666528..2667547 [-]
Producttype VI secretion-associated protein, ImpA family
NoteTssA
UniProt IDD0KEY4
KEGG IDpwa:Pecwa_2462
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.30E-18, Aligned region: 54..113
Protein Sequence: 339 a.a.     [Download]
>gi|261821724|ref|YP_003259830.1| type VI secretion-associated protein, ImpA family [Pectobacterium wasabiae WPP163]
MTINVDALLAPVSRDNPCGDNLEYHADFQAMEQASTGKAEQQFGNTIIPAEPADWNKVEKLAIDLLSRSK
DLRVILALTHAWTELKGLPGYAQGLKLIEQALLLYWEPLWPRLNEFSEEDPFYRINAVALLGDKSALSGA
VRQSWLLRYASDGITLRDAVALCDGSKTDVAEYPGGLPRLTDELARGEQPGTEAVLQIAGYLQTISETLA
ERLGESAVPELVQLRKQIAIIAERCQATDLNALRPKVTTAQPAETVAPVALTPMRVTADWRSLPLNSRAD
AQLMLEKVKQYFTQHEPSHPAPLMIDRVQRLIELDFMDIIRDLAPDGVHQMENIFGRRD
 
Nucleotide Sequence: 1020 bp     [Download]
>gi|261819370|ref|NC_013421.1|:c2667547-2666528 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGACGATAAATGTAGATGCCTTGCTGGCACCGGTTAGCCGTGACAATCCCTGCGGCGACAACCTGGAGT
ATCACGCGGATTTTCAGGCGATGGAACAGGCTAGCACGGGCAAAGCCGAGCAGCAGTTCGGTAACACCAT
TATCCCGGCGGAACCGGCGGACTGGAATAAAGTTGAAAAGCTGGCGATTGACTTACTGAGTCGCAGTAAA
GACCTGCGCGTGATATTAGCGCTGACGCATGCATGGACCGAATTGAAAGGCCTGCCGGGTTACGCTCAAG
GGTTGAAACTGATTGAGCAGGCACTGCTGCTGTACTGGGAGCCACTGTGGCCGCGTCTGAACGAGTTCAG
CGAAGAAGATCCGTTTTATCGCATCAATGCTGTGGCGCTGCTGGGGGATAAATCGGCACTAAGCGGTGCG
GTGCGCCAGTCCTGGCTGCTGCGTTATGCCTCGGACGGCATCACGCTGCGCGATGCCGTGGCGCTATGTG
ATGGTAGCAAAACGGACGTTGCCGAGTATCCCGGCGGTTTGCCACGCCTGACTGATGAACTGGCGCGCGG
CGAACAGCCCGGCACAGAAGCGGTTCTGCAAATAGCGGGATATTTACAAACTATTAGTGAAACCCTTGCT
GAGCGCTTGGGTGAATCGGCGGTACCAGAGTTGGTACAACTGCGTAAACAGATTGCGATAATCGCCGAAC
GTTGTCAGGCCACCGATCTCAACGCCCTACGGCCCAAGGTTACCACTGCACAACCCGCCGAAACTGTCGC
ACCGGTTGCACTTACCCCGATGCGTGTTACCGCTGACTGGCGTAGTTTACCGCTCAATTCACGTGCCGAT
GCGCAACTGATGCTGGAGAAAGTGAAGCAGTATTTCACTCAGCATGAGCCAAGCCATCCGGCTCCGCTGA
TGATTGACCGCGTGCAGCGTCTGATCGAACTCGACTTTATGGACATTATCCGCGATCTCGCGCCGGATGG
TGTGCATCAGATGGAAAATATTTTTGGACGCCGCGACTAA