SecReT6
Protein ID: 261821727
SecReT6 ID369
T6SS typei3
Gene symbol-
Locus tagPecwa_2465
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T6SS(s) in this replicon]
Location [Strand]2671908..2673149 [-]
Producthypothetical protein
NoteTssL
UniProt IDD0KEY7
KEGG IDpwa:Pecwa_2465
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.60E-70, Aligned region: 21..226
DUF2077 [PF09850], Evalue: 4.60E-70, Aligned region: 362..390
OmpA [PF00691], Evalue: 4.70E-15, Aligned region: 291..389
Protein Sequence: 413 a.a.     [Download]
>gi|261821727|ref|YP_003259833.1| hypothetical protein Pecwa_2465 [Pectobacterium wasabiae WPP163]
MMQEQQNPNHDATQQDINHQNMLVAAANPLINAIPQIRHSVSHDDPARLRQQLIDQVRLFELNCQQSGLS
YEVIVGARYCLCTALDEAAALTPWGSRGVWTSNSLLVTFHNETWGGEKFFQLLAKLSQSPRQHILLLELI
YFCLLLGFEGRYRVLDNGRSQLETIKQRLLQMIKSVRGSYFAALSPHPTDQPVLRKRWRPMIPLWACAAV
AGFAACLFYIGLNWRLGDYTSPVLASIYQTTLPEVKIRNPAPPPPASLNLKSFLKPEIDAGLVAVRDEAD
QSVVTLKGDGLFASASTDVRGRYDVVIKRVAEAMNNVRGKVLVIGYSDNVPIRSARFASNYELSLARAQS
VQTLLQQQLTQPSRVTAAGRGENHPLVPNTNAENRARNRRVEITLLVAPDATQAELNGLARGE
 
Nucleotide Sequence: 1242 bp     [Download]
>gi|261819370|ref|NC_013421.1|:c2673149-2671908 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGATGCAGGAACAACAGAACCCGAACCATGATGCCACGCAGCAGGATATCAACCACCAGAATATGTTGG
TGGCGGCTGCCAACCCGCTGATTAACGCTATTCCTCAGATTCGACACTCCGTCTCCCATGACGATCCGGC
ACGCCTACGCCAGCAACTGATCGACCAGGTTCGACTCTTCGAGCTGAACTGCCAGCAGTCTGGCCTGAGT
TACGAAGTGATTGTTGGTGCCCGTTATTGTCTATGCACCGCGCTGGATGAAGCCGCTGCGCTGACGCCGT
GGGGTAGCCGTGGAGTGTGGACCAGTAACAGCCTGCTGGTGACATTTCACAATGAAACCTGGGGGGGCGA
GAAGTTTTTCCAACTACTGGCGAAGCTGTCACAGAGTCCGCGTCAGCACATTCTGCTGCTGGAGCTGATC
TACTTCTGCCTGCTGCTGGGCTTTGAAGGGCGCTACCGCGTGTTGGATAATGGCCGTTCACAGTTGGAAA
CCATCAAGCAGCGTCTGCTGCAGATGATCAAAAGCGTGCGCGGCAGCTACTTTGCGGCACTCTCTCCCCA
TCCGACCGATCAGCCGGTGCTGCGTAAGCGGTGGCGTCCAATGATCCCGTTGTGGGCCTGCGCTGCCGTT
GCCGGTTTTGCTGCCTGCTTGTTCTATATTGGCCTTAACTGGCGTCTCGGTGATTACACCTCGCCAGTGC
TGGCCAGCATCTATCAGACGACGCTGCCGGAAGTGAAAATCCGCAATCCTGCACCACCTCCGCCTGCCTC
GTTGAACCTGAAATCCTTCCTGAAACCGGAGATCGATGCCGGTCTGGTCGCGGTACGCGATGAAGCTGAC
CAAAGCGTGGTAACGCTGAAAGGCGATGGGCTATTTGCTTCGGCATCAACCGACGTGCGTGGACGCTACG
ATGTCGTGATTAAGCGCGTTGCGGAAGCGATGAACAACGTGCGCGGCAAGGTTTTGGTGATTGGCTACAG
CGATAACGTGCCTATTCGCAGCGCCCGTTTTGCCTCCAACTATGAACTCTCGCTGGCGCGTGCGCAGTCG
GTGCAAACCCTGTTGCAGCAGCAGTTGACGCAGCCGTCACGCGTTACAGCCGCAGGGCGTGGCGAAAACC
ACCCGCTGGTGCCGAATACCAACGCAGAGAATCGCGCTCGTAACCGCCGCGTAGAGATTACGCTGCTGGT
CGCGCCAGACGCGACGCAAGCGGAACTCAACGGCTTGGCGAGAGGGGAGTAA