SecReT6
Protein ID: 261821728
SecReT6 ID369
T6SS typei3
Gene symbol-
Locus tagPecwa_2466
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T6SS(s) in this replicon]
Location [Strand]2673169..2674509 [-]
Producthypothetical protein
NoteTssK
UniProt IDD0KEY8
KEGG IDpwa:Pecwa_2466
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 9.70E-146, Aligned region: 19..442
Protein Sequence: 446 a.a.     [Download]
>gi|261821728|ref|YP_003259834.1| hypothetical protein Pecwa_2466 [Pectobacterium wasabiae WPP163]
MNRSEKVVWTEGMFLRPHHFQQSENYLHSTLRDWGQSQRAYTWGFFDLEFDEALLRQGKLALSAASGCLP
DGTFFSFSLPQHGPAPLELPANVDRANVVLAIPARRNGREAVVFQETQDSLARYLAWETEVEDDNAQAIG
AATVQFGKLRLRLMLEQDLTAEWTAMGVAQVIEKRSGNHLRLDTDYIPPMLALNGSRPLQSMLNDLHGLM
QQRSQQLSQRAQGTGRFNSADMVDFMLLAMLNRQLGLHAHLQHLPLLHPETLYRYWLQLAAELCTWMPAR
TPEPLPLYNHDDLHGCFTRLTLLLRQGLSQVMEESAIQLPLTQRSHGLNVATVPESSMVREFGFVLAVKA
SVPAEALKTHFPAQMKVAPVTKIRDLVQLQLPGLVLKAMPGAPPQIPWHAGYSYFELDKNGELWKEMERS
GAFALHLAGEFPGLDMEFWAIRSSSE
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|261819370|ref|NC_013421.1|:c2674509-2673169 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGAACAGATCCGAAAAGGTGGTTTGGACCGAAGGGATGTTCCTGCGTCCTCACCATTTCCAGCAGTCGG
AAAATTATCTTCACAGCACACTACGTGATTGGGGCCAGTCGCAACGCGCTTATACCTGGGGATTCTTCGA
TCTGGAGTTTGATGAAGCGCTGCTGCGTCAGGGAAAACTAGCGCTAAGTGCCGCCAGCGGTTGCCTGCCG
GATGGCACGTTCTTTTCCTTCAGCCTGCCGCAACATGGACCAGCACCGCTTGAACTGCCTGCCAATGTTG
ATCGTGCTAACGTGGTGCTGGCGATCCCAGCCCGCCGCAATGGTCGAGAAGCGGTGGTGTTTCAGGAGAC
ACAAGATTCTCTGGCTCGCTATCTCGCTTGGGAAACCGAAGTGGAAGATGACAACGCGCAGGCGATCGGC
GCGGCTACAGTACAGTTCGGTAAACTGCGTTTGCGTCTGATGCTGGAGCAAGATCTCACCGCAGAATGGA
CGGCAATGGGCGTAGCGCAGGTGATTGAGAAGCGCAGCGGTAACCACCTGCGCCTTGATACCGATTACAT
CCCACCGATGCTGGCGCTCAACGGCAGTCGGCCACTGCAAAGCATGCTTAACGATCTGCATGGTCTGATG
CAGCAGCGCAGTCAGCAACTAAGCCAGCGTGCGCAAGGTACTGGTCGCTTCAACAGTGCTGACATGGTCG
ATTTTATGCTACTGGCCATGCTGAATCGCCAACTCGGCCTGCATGCGCATCTGCAACATTTGCCGCTATT
GCATCCTGAAACGCTCTACCGCTATTGGTTGCAACTGGCTGCTGAACTCTGTACCTGGATGCCAGCACGC
ACGCCTGAACCCTTGCCGCTTTACAACCACGATGACCTGCACGGCTGTTTTACCCGTTTAACGCTGCTGC
TGCGTCAGGGGCTATCTCAGGTAATGGAAGAAAGTGCGATTCAGCTTCCACTCACCCAGCGCTCACACGG
TCTTAACGTTGCCACGGTGCCGGAAAGCAGCATGGTACGCGAATTCGGCTTTGTGCTGGCAGTAAAAGCC
AGTGTGCCTGCCGAAGCCCTGAAAACCCACTTCCCAGCACAAATGAAAGTCGCACCAGTTACCAAAATCC
GCGATCTGGTTCAACTGCAACTACCCGGCCTGGTGTTGAAAGCCATGCCGGGTGCACCGCCGCAAATTCC
ATGGCATGCCGGTTACAGCTACTTCGAGCTGGATAAGAACGGCGAGCTGTGGAAAGAGATGGAACGCTCC
GGTGCGTTTGCACTTCATCTAGCTGGTGAGTTTCCGGGCCTGGACATGGAGTTCTGGGCCATTCGTAGTT
CATCAGAATAA