SecReT6
Protein ID: 261821729
SecReT6 ID369
T6SS typei3
Gene symbol-
Locus tagPecwa_2467
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T6SS(s) in this replicon]
Location [Strand]2674519..2675013 [-]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDD0KEY9
KEGG IDpwa:Pecwa_2467
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.10E-26, Aligned region: 16..133
Protein Sequence: 164 a.a.     [Download]
>gi|261821729|ref|YP_003259835.1| type VI secretion lipoprotein [Pectobacterium wasabiae WPP163]
MMTIMQLRCWLLPLLALLLIACSSSPTPVARYNLHFQAHPQINSGAPLKVRVMLLTSDAEFMSADFYSLQ
NQPADALGSTLLNNQQFFLMSGQLSKMLNAKSLPEARYIGIMAEYQALDGKVWRLALPFPDGENSAFWVF
WKSNDDELNAHMMADINGLRVVKQ
 
Nucleotide Sequence: 495 bp     [Download]
>gi|261819370|ref|NC_013421.1|:c2675013-2674519 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGATGACAATAATGCAACTGCGCTGCTGGCTGTTACCGCTACTAGCATTGCTACTGATTGCGTGCAGCA
GCAGTCCCACTCCGGTGGCGCGTTATAACTTGCACTTCCAGGCGCACCCGCAGATCAACAGCGGCGCACC
GCTCAAGGTGCGGGTGATGTTATTGACTTCAGACGCGGAATTCATGTCCGCCGACTTCTACTCCCTGCAG
AATCAGCCCGCAGATGCATTGGGTAGCACGTTGCTCAACAACCAACAGTTTTTCCTGATGTCAGGTCAAC
TGAGCAAAATGCTTAACGCCAAAAGTCTGCCAGAAGCGCGCTACATTGGCATCATGGCGGAGTATCAGGC
GCTGGACGGCAAAGTCTGGCGGCTGGCGCTACCGTTCCCAGATGGTGAGAACAGCGCGTTTTGGGTGTTC
TGGAAAAGTAACGACGATGAGTTGAACGCCCACATGATGGCGGACATCAACGGCCTTCGCGTGGTTAAGC
AGTAA