SecReT6
Protein ID: 262192881
SecReT6 ID193
T6SS typei3
Gene symbol-
Locus tagBMA10247_A2175
StrainBurkholderia mallei NCTC 10247
Repliconchromosome II [GenBank: NC_009079] [Browse all T6SS(s) in this replicon]
Location [Strand]2112119..2113156 [-]
ProductImpA-related N-terminal family protein
NoteTssA
UniProt IDA3MGG0
KEGG IDbmn:BMA10247_A2175
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 7.20E-21, Aligned region: 46..106
ImpA-rel_N [PF06812], Evalue: 7.20E-21, Aligned region: 118..132
ImpA-rel_N [PF06812], Evalue: 7.20E-21, Aligned region: 182..198
Protein Sequence: 345 a.a.     [Download]
>gi|262192881|ref|YP_001079346.3| ImpA-related N-terminal family protein [Burkholderia mallei NCTC 10247]
MAPVDAAAPCGADLEYDPEFVVLAAKVAPRAEAQYGDFVGSPEPVNWSDVERDCRRLMMRSKDMRLAVLF
ARSRTRLAGATGLAEGIGLLAAWLAAFPDAIHPQADVDADRDAALEIRRNALQALTDADGLLADVREIAL
TRSSATRLQVRDVERAFAQPRPGDALAPESVVRQLDDLHAQQPETLAGFGDALAGLAAIDAWSGEHLGDY
APDLSALDALLRRIAGANARGDRAEAEPIAPAEADAPPASEAAAAHAHASPPRRREPAAQALAAAIAGEP
AAQPVDRYAARELIRQARQWFEQHEPSSPIPILLRRAEHFVGKRYADVVQAIPAELLALWSADET
 
Nucleotide Sequence: 1038 bp     [Download]
>gi|126445587|ref|NC_009079.1|:c2113156-2112119 Burkholderia mallei NCTC 10247 chromosome II, complete sequence
ATGGCGCCCGTCGATGCGGCCGCGCCGTGCGGAGCGGACCTTGAATACGATCCCGAGTTCGTCGTGCTCG
CGGCGAAGGTCGCGCCGCGCGCCGAAGCGCAGTACGGGGACTTCGTCGGCTCGCCGGAGCCGGTGAACTG
GAGCGACGTCGAGCGCGACTGCCGACGGCTGATGATGCGCAGCAAGGACATGCGCCTCGCGGTGCTGTTC
GCGCGCAGCCGCACGCGGCTTGCCGGCGCGACCGGGCTCGCGGAAGGCATTGGCTTGCTGGCCGCGTGGC
TCGCCGCGTTTCCCGATGCGATTCATCCGCAAGCCGACGTCGACGCGGACCGCGACGCGGCGCTCGAGAT
CCGGCGCAACGCGCTGCAGGCGCTGACCGATGCCGACGGGCTGCTGGCGGACGTGCGCGAGATCGCGCTG
ACCCGCTCGAGCGCGACGCGCCTGCAGGTGCGCGACGTGGAACGCGCGTTCGCGCAACCGCGGCCCGGCG
ATGCGCTCGCGCCGGAATCGGTCGTGCGCCAGCTCGACGATTTGCACGCGCAGCAGCCGGAGACGCTCGC
GGGCTTCGGCGATGCGCTCGCGGGGCTGGCCGCGATCGACGCCTGGAGCGGCGAGCATCTCGGCGATTAT
GCGCCGGACCTGTCGGCGCTCGATGCGCTGCTTCGCCGGATCGCGGGCGCGAACGCGCGCGGCGATCGCG
CGGAGGCCGAGCCGATCGCGCCGGCCGAAGCCGATGCGCCGCCGGCGAGCGAGGCGGCGGCCGCGCACGC
GCACGCATCGCCGCCGCGGCGGCGCGAGCCCGCGGCGCAGGCACTCGCGGCTGCCATTGCGGGCGAACCG
GCCGCGCAGCCGGTGGATCGTTACGCGGCGCGCGAGCTGATCCGGCAGGCGCGCCAGTGGTTCGAGCAGC
ACGAGCCGAGCAGCCCGATTCCGATTCTGCTCAGGCGCGCGGAGCATTTCGTCGGCAAGCGCTATGCGGA
TGTGGTGCAGGCGATTCCCGCCGAGCTGCTCGCGCTGTGGAGCGCGGACGAAACCTGA