SecReT6
Protein ID: 262395311
SecReT6 ID370
T6SS typei5
Gene symbol-
Locus tagVEA_000012
StrainVibrio sp. Ex25
Repliconchromosome II [GenBank: NC_013457] [Browse all T6SS(s) in this replicon]
Location [Strand]9169..10362 [+]
Producthypothetical protein
NoteFha
UniProt IDD0MCI5
KEGG IDvex:VEA_000012
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.30E-15, Aligned region: 32..101
Protein Sequence: 397 a.a.     [Download]
>gi|262395311|ref|YP_003287164.1| hypothetical protein VEA_000012 [Vibrio sp. Ex25]
MKLVLTITSFHKFTPEIESEFVFESSDEHAKVTFGRSEQCDWTLPDPERVVSGTHGELIKFGDKYLIKDL
STNGTFVNNAVTPVGQGNEIALSDDDTVSLGDYQISVSIQTSTEAFNNQESNFRSSSEPEAFSSSSEAEF
VDLGLSASELLNESVPSDFQLDIGLVDDFIDIPKPEKQSVDPTPVPETPRQLERQSTPKFDSKGSELAAF
IKGAGIDPTMIPSDNREQWFEQLGESFSLMLVGLMETLHNRAVFKQTNRLSHTAFRKSENNPLKFSANLE
DAIHNLYNRQTASFLKPSAAIKEAFSDIENHEQALMKGVEGTVSSVMSLVEPTSIYSEALAKDTVINKVI
PARKYAQSWKRFEDIHEKLSDDIINKESPFYLEDFAKHYELALKNKS
 
Nucleotide Sequence: 1194 bp     [Download]
>gi|262395299|ref|NC_013457.1|:9169-10362 Vibrio sp. Ex25 chromosome 2, complete genome
ATGAAGTTGGTTTTAACCATAACAAGTTTTCACAAATTTACTCCAGAGATTGAGAGTGAGTTTGTGTTTG
AATCAAGTGATGAGCATGCCAAAGTTACGTTTGGTCGGTCTGAGCAATGTGATTGGACACTGCCAGACCC
TGAAAGAGTAGTATCCGGAACTCACGGAGAGCTCATCAAGTTTGGTGATAAATACTTGATAAAAGACTTA
TCAACTAATGGCACGTTTGTTAATAACGCTGTGACACCTGTGGGCCAAGGAAATGAGATTGCACTAAGTG
ACGACGATACGGTTAGTTTAGGGGATTACCAAATTTCAGTAAGTATTCAAACGAGCACTGAGGCATTCAA
TAATCAGGAAAGTAACTTTCGTTCCAGTTCAGAACCTGAAGCATTCTCGAGTTCATCTGAAGCAGAGTTT
GTAGACCTCGGCCTTAGTGCCAGTGAGCTTTTGAATGAGAGTGTTCCTTCGGACTTTCAACTAGATATTG
GCTTAGTCGATGATTTTATTGATATCCCCAAACCAGAAAAACAGAGTGTAGATCCTACACCTGTACCGGA
AACCCCACGACAGCTAGAACGTCAATCAACTCCCAAATTTGATAGTAAAGGGAGCGAGCTTGCGGCGTTC
ATTAAAGGGGCGGGTATTGATCCAACGATGATTCCCAGCGATAACAGAGAGCAATGGTTTGAACAACTGG
GGGAATCATTTTCTTTGATGTTAGTTGGTTTAATGGAAACGCTGCACAATCGAGCGGTATTTAAACAAAC
AAATCGACTAAGTCATACTGCGTTTCGGAAGTCAGAAAATAATCCTCTGAAGTTCTCTGCGAATTTAGAA
GATGCAATTCATAACTTATATAACCGTCAAACTGCAAGTTTCCTAAAACCAAGTGCAGCCATTAAAGAAG
CGTTTAGTGATATAGAAAATCATGAACAAGCGTTAATGAAAGGTGTTGAGGGTACGGTTTCAAGTGTTAT
GTCGCTTGTTGAGCCTACGTCGATATACTCAGAAGCTTTAGCTAAAGACACGGTTATTAATAAGGTTATT
CCAGCAAGAAAATATGCTCAAAGTTGGAAGCGGTTTGAGGATATTCATGAAAAGCTATCCGATGACATTA
TCAATAAAGAATCTCCATTTTATTTAGAAGATTTCGCTAAACACTATGAGTTAGCATTAAAAAATAAAAG
CTAG