SecReT6
Protein ID: 262395312
SecReT6 ID370
T6SS typei5
Gene symbol-
Locus tagVEA_000013
StrainVibrio sp. Ex25
Repliconchromosome II [GenBank: NC_013457] [Browse all T6SS(s) in this replicon]
Location [Strand]10374..10829 [+]
Producttype VI secretion lipoprotein/VasD
NoteTssJ
UniProt IDD0MCI6
KEGG IDvex:VEA_000013
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 9.40E-40, Aligned region: 14..147
Protein Sequence: 151 a.a.     [Download]
>gi|262395312|ref|YP_003287165.1| type VI secretion lipoprotein/VasD [Vibrio sp. Ex25]
MKRVYQYILLLISMVLFGCSAANLVVDPYSDLEITANHNINPDSNGRPSPVVVYVFELTSNTLFESQDFF
SIYEESEKVLGPDLVNKYEISLTPGQKETYQASMSPKTEYLGIVAAFRDIENSNWRQVIEVDKTGYNTYQ
ILLEDLSLVVK
 
Nucleotide Sequence: 456 bp     [Download]
>gi|262395299|ref|NC_013457.1|:10374-10829 Vibrio sp. Ex25 chromosome 2, complete genome
ATGAAAAGAGTTTATCAGTACATTTTGTTATTAATTTCAATGGTTTTATTTGGATGCTCAGCAGCCAATT
TAGTTGTTGACCCATATTCAGATTTAGAAATAACAGCAAATCACAATATTAACCCTGACTCCAATGGTAG
GCCATCCCCTGTAGTCGTGTATGTTTTTGAATTAACATCAAATACCCTTTTTGAAAGTCAGGATTTTTTT
TCAATTTATGAAGAAAGTGAAAAAGTCTTAGGCCCTGATTTAGTGAATAAATATGAAATATCATTAACTC
CAGGTCAGAAAGAAACATATCAGGCAAGTATGTCTCCAAAGACTGAATACTTAGGCATTGTCGCAGCGTT
TCGAGATATTGAAAATTCAAATTGGCGACAAGTCATTGAAGTGGATAAGACCGGTTACAACACCTATCAA
ATTCTGTTAGAAGATCTGTCTTTGGTCGTAAAATAA