SecReT6
Protein ID: 262395313
SecReT6 ID370
T6SS typei5
Gene symbol-
Locus tagVEA_000014
StrainVibrio sp. Ex25
Repliconchromosome II [GenBank: NC_013457] [Browse all T6SS(s) in this replicon]
Location [Strand]10887..12176 [+]
Producthypothetical protein
NoteTssK
UniProt IDD0MCI7
KEGG IDvex:VEA_000014
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.20E-131, Aligned region: 7..427
Protein Sequence: 429 a.a.     [Download]
>gi|262395313|ref|YP_003287166.1| hypothetical protein VEA_000014 [Vibrio sp. Ex25]
MFLRPQHFQQHERATSQEFKGLHQFGGAYNWGVWKCRVKEHALKDGLIELDHFEAVLPDMTLVNTLTASD
SVVPLFIDKDVENTLVKITLPLSNVKGKNVSDVSEAIVSRYVLKDVDVIDNLTGQDEETIQVAALNLELK
ASNDKLAGYVELPILKIKEVTAEGEVILDDSYVPPLINLLSDKVMSAYLRNVIAMTKMRADVIAQRLIKG
KAASASAVDFIMLQMLNRYEAMLKHFSDLDRLHPLELATTLKGYIGELATFSDKTKRMPSLLTYDHLDVS
SVYSELNQVLSQYLSVVLDQTASKLPLEPRQYGIQVTPLPDKRLLESCQFVLAVKADTTTDEIRRLVPAQ
LKFGPAEQIRDLINNQINGINVAPLSVVPRQIPYQTGYVYFEVVKKGPFWMRLKDSGGIALHLSGHFPNA
DLELWSISQ
 
Nucleotide Sequence: 1290 bp     [Download]
>gi|262395299|ref|NC_013457.1|:10887-12176 Vibrio sp. Ex25 chromosome 2, complete genome
ATGTTTTTACGTCCCCAGCACTTTCAACAACATGAACGCGCAACCTCTCAAGAATTCAAAGGCTTACATC
AGTTTGGTGGGGCTTATAATTGGGGGGTTTGGAAATGTCGAGTAAAAGAACATGCATTAAAAGATGGTCT
GATTGAATTAGATCACTTTGAGGCAGTTTTGCCAGATATGACTCTGGTTAATACCTTAACAGCCAGCGAT
TCGGTTGTGCCTTTATTTATTGATAAAGACGTAGAAAATACGTTAGTAAAAATCACTCTTCCCCTTTCAA
ATGTCAAAGGTAAAAATGTTTCTGATGTAAGTGAGGCGATCGTTTCTCGTTATGTACTTAAAGACGTTGA
CGTTATAGATAATCTCACTGGGCAGGATGAAGAAACGATTCAAGTCGCAGCCCTAAACCTGGAACTGAAA
GCCAGCAATGACAAATTAGCGGGTTATGTTGAGTTACCGATATTGAAAATAAAAGAGGTAACGGCAGAAG
GCGAAGTAATACTAGACGATTCGTATGTTCCACCGCTTATCAATTTACTTAGCGACAAAGTTATGTCGGC
TTACTTGCGTAACGTTATTGCGATGACAAAGATGCGTGCCGACGTTATTGCGCAGCGATTGATTAAGGGC
AAAGCCGCATCTGCATCTGCTGTTGATTTCATCATGCTACAAATGTTGAACAGGTATGAGGCGATGTTAA
AGCACTTTAGTGACCTAGACAGGCTACATCCATTGGAATTAGCGACGACCCTGAAAGGTTATATTGGTGA
ATTAGCTACGTTTTCTGACAAAACTAAGAGGATGCCAAGCTTACTTACATACGATCACTTAGATGTATCA
AGTGTTTATAGCGAATTGAATCAAGTTCTGAGTCAATATCTGAGCGTTGTCCTTGATCAAACAGCAAGCA
AACTTCCTTTGGAGCCACGACAATATGGAATTCAAGTGACGCCACTTCCAGATAAGCGTTTACTTGAATC
ATGCCAGTTTGTGCTTGCGGTCAAAGCTGATACGACAACAGATGAAATCAGACGTTTAGTCCCGGCGCAG
CTCAAGTTTGGACCAGCGGAGCAGATTCGTGATCTGATCAACAATCAGATTAATGGAATAAACGTAGCGC
CATTGAGTGTAGTACCGAGGCAGATCCCTTACCAAACGGGTTATGTCTACTTCGAAGTAGTCAAGAAAGG
CCCGTTTTGGATGAGGCTGAAAGACAGTGGTGGTATTGCGCTGCATTTATCGGGGCATTTTCCGAATGCT
GACCTTGAGCTGTGGAGTATTAGTCAATAG