SecReT6
Protein ID: 262395314
SecReT6 ID370
T6SS typei5
Gene symbol-
Locus tagVEA_000015
StrainVibrio sp. Ex25
Repliconchromosome II [GenBank: NC_013457] [Browse all T6SS(s) in this replicon]
Location [Strand]12188..13480 [+]
ProductFlagellar motor rotation protein MotB
NoteTssL
UniProt IDD0MCI8
KEGG IDvex:VEA_000015
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.40E-62, Aligned region: 49..254
OmpA [PF00691], Evalue: 2.80E-14, Aligned region: 322..420
Protein Sequence: 430 a.a.     [Download]
>gi|262395314|ref|YP_003287167.1| Flagellar motor rotation protein MotB [Vibrio sp. Ex25]
MEQTIVKPTPGGRAPAPKPQSEKSADNTVVISKSPELVNNDSVVAYGNNPLLAEANGLLSIIGQIRATAT
HSDPLFLKETLAQKLRDYENRLRHHDVDLDTIDTARYCLCCSLDEAVLNTNWGGHSFWSHDSLLSSFYAS
SQGGEAFFKYLDKCMAQPDTNLDLLELMYVCLSLGFLGQYRLEKNGLESHRKLRRQIIAILKSYGRGIPQ
ELSNSIEQHILNGSKASDRAPLWVVCSVTAALLVCIFMYFSYELNKASNRTFSQLVNLVQPQQLNQDTTS
ESKSAPISERISMYLATEIGKGLINVEPLQDRVRISLKSQDLFESGSADVVAYIQPVISKLARTLESTQG
KIIVTGHTDDRPIFTSKYPSNWHLSLARATAMSEQLISNSTLEGRVIPEGLGDARPLVENNSDENRAINR
RIEIDLLVAN
 
Nucleotide Sequence: 1293 bp     [Download]
>gi|262395299|ref|NC_013457.1|:12188-13480 Vibrio sp. Ex25 chromosome 2, complete genome
ATGGAACAAACGATCGTAAAACCAACACCGGGTGGAAGAGCGCCCGCACCGAAACCACAATCAGAAAAGT
CAGCAGATAATACGGTAGTTATCTCAAAAAGTCCTGAATTGGTGAATAACGATTCAGTGGTCGCTTATGG
GAACAACCCTTTATTGGCAGAAGCGAATGGTCTTTTATCCATTATTGGTCAAATTCGAGCGACAGCGACT
CATTCTGACCCGTTGTTTCTAAAAGAGACGTTGGCACAAAAACTTAGAGATTATGAGAACCGACTACGTC
ACCACGACGTTGATTTGGACACTATTGATACGGCTCGTTACTGTTTGTGTTGCTCGTTAGATGAAGCGGT
GCTCAATACTAATTGGGGGGGGCATTCATTTTGGAGCCATGACTCATTGCTTAGTTCTTTCTATGCCAGC
AGCCAGGGTGGGGAAGCGTTCTTTAAGTACCTTGATAAGTGCATGGCGCAACCAGATACAAATTTAGATT
TGCTTGAATTGATGTACGTGTGCCTATCGCTTGGGTTTCTCGGCCAATATCGTTTGGAAAAAAACGGACT
GGAGTCTCACCGAAAACTGAGAAGGCAGATTATCGCTATTCTTAAGTCTTACGGAAGAGGGATACCTCAA
GAGCTAAGCAATAGTATCGAACAACACATTTTGAATGGCTCTAAGGCTTCCGACAGAGCTCCTCTCTGGG
TTGTGTGCTCCGTAACGGCTGCATTATTGGTTTGTATATTTATGTATTTTAGCTATGAGCTAAACAAGGC
TTCCAACCGCACCTTTTCTCAATTAGTCAATTTGGTTCAACCGCAACAGCTTAACCAAGATACAACGTCA
GAATCAAAATCAGCGCCAATTTCAGAAAGGATCTCTATGTATCTGGCAACCGAGATCGGGAAGGGGCTAA
TTAACGTCGAGCCGTTGCAAGACAGGGTAAGAATTTCGTTAAAATCGCAAGATCTATTTGAATCAGGTAG
TGCTGATGTTGTTGCGTATATCCAACCCGTAATTTCTAAACTCGCTAGAACGTTGGAGTCGACCCAAGGC
AAGATCATTGTAACAGGTCATACCGATGATAGGCCAATTTTCACGAGTAAATATCCTTCGAACTGGCATC
TATCATTAGCTCGAGCTACTGCTATGTCTGAACAACTTATCTCGAATAGCACACTAGAAGGTCGAGTCAT
ACCAGAAGGGCTGGGTGATGCAAGACCATTGGTTGAAAACAATAGTGACGAAAACCGAGCTATTAACCGT
CGAATTGAAATCGACCTCCTTGTCGCGAATTAA