SecReT6
Protein ID: 262395318
SecReT6 ID370
T6SS typei5
Gene symbol-
Locus tagVEA_000019
StrainVibrio sp. Ex25
Repliconchromosome II [GenBank: NC_013457] [Browse all T6SS(s) in this replicon]
Location [Strand]18489..19607 [+]
Producthypothetical protein
NoteTssA
UniProt IDD0MCJ2
KEGG IDvex:VEA_000019
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.60E-21, Aligned region: 67..127
Protein Sequence: 372 a.a.     [Download]
>gi|262395318|ref|YP_003287171.1| hypothetical protein VEA_000019 [Vibrio sp. Ex25]
MNSEMFDWYEQALAPISQENPTGVDPREDVSPQSAYYRLKDQRMAARNAERNALIEEESIYTHSNLWRVF
IEEVPEILTNQSKDLEFVAWLIEALTRLHGFRGMGVGYKLATEFIEKFWDDLYPMPDEDGIETRISAITG
LNGIDSEGTLIFPIACIPLTDVGVEQAYAYWEYQQAIELERLDEDKRRNRVDLGATELSDITTTVKSTSD
AFYRELIADLEFATESFNEFSQRLDEAVGDVTPSSYISKRLESIHSALKHLLGERFNQPQAVFEELEEVD
ESSSSEQQVSSQSSDALLATNMKSREQAIRQLQQVADFFRESEPHSPVSYSIEQIIRWCGMPLPELLAEL
ISDGDAKKSYFRLVGIAEQNEN
 
Nucleotide Sequence: 1119 bp     [Download]
>gi|262395299|ref|NC_013457.1|:18489-19607 Vibrio sp. Ex25 chromosome 2, complete genome
ATGAATAGTGAGATGTTCGATTGGTATGAACAAGCGTTGGCTCCTATATCTCAAGAGAATCCCACAGGTG
TTGATCCTAGAGAAGATGTATCGCCACAGTCCGCTTATTACCGATTAAAAGATCAGCGTATGGCTGCGCG
AAATGCAGAGCGTAATGCGCTTATAGAAGAAGAAAGTATTTATACCCACAGTAACTTATGGCGGGTATTT
ATTGAAGAAGTACCAGAGATACTTACGAATCAATCTAAAGATTTAGAGTTTGTGGCTTGGCTTATAGAGG
CTCTAACTCGATTGCATGGTTTTCGTGGTATGGGCGTTGGGTACAAACTCGCAACCGAGTTCATCGAGAA
GTTTTGGGATGATCTCTATCCAATGCCTGATGAGGATGGTATTGAAACAAGAATATCGGCGATTACTGGC
CTCAATGGTATCGATAGCGAAGGAACACTTATTTTCCCTATTGCTTGTATCCCGCTTACTGACGTAGGCG
TTGAGCAAGCGTATGCCTACTGGGAATATCAGCAAGCTATTGAGTTGGAGCGTTTAGATGAAGATAAGCG
CCGAAATCGAGTCGATCTTGGCGCTACAGAGCTATCTGATATTACAACTACAGTTAAATCTACCTCTGAT
GCCTTTTATCGTGAGCTAATCGCTGATCTGGAGTTCGCCACAGAGTCATTTAATGAATTCAGTCAGCGAT
TAGATGAAGCGGTAGGTGATGTCACTCCTAGCTCTTATATATCAAAAAGGCTTGAATCAATACACTCGGC
ATTAAAGCATCTCCTTGGAGAGCGTTTTAATCAACCACAAGCTGTGTTTGAAGAACTGGAGGAGGTGGAT
GAATCTTCTTCTTCGGAACAACAAGTGAGTTCACAAAGTTCTGATGCACTATTAGCGACAAACATGAAAT
CACGAGAGCAGGCGATTAGACAATTGCAGCAAGTGGCTGATTTCTTCAGAGAGAGTGAGCCTCACTCACC
AGTTTCTTACTCCATCGAACAGATCATTCGTTGGTGTGGAATGCCTCTGCCGGAGTTACTGGCGGAACTT
ATCTCCGACGGAGATGCAAAGAAAAGCTACTTCCGTTTGGTTGGCATAGCAGAACAAAATGAAAATTAA