SecReT6
Protein ID: 262395319
SecReT6 ID370
T6SS typei5
Gene symbol-
Locus tagVEA_000020
StrainVibrio sp. Ex25
Repliconchromosome II [GenBank: NC_013457] [Browse all T6SS(s) in this replicon]
Location [Strand]19623..20153 [+]
Producthypothetical protein
NoteTssB
UniProt IDD0MCJ3
KEGG IDvex:VEA_000020
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.40E-62, Aligned region: 8..162
Protein Sequence: 176 a.a.     [Download]
>gi|262395319|ref|YP_003287172.1| hypothetical protein VEA_000020 [Vibrio sp. Ex25]
MTSIHSKLSRVRKPRVHITYDVETEGTTLKKELPFVVGVMGDFAGQNTEALKPLKDRRFIQIDRDNFDDV
LKKMNPSVKFKVANKLANDDSQFEVDLNFKSMQDFEPAAIVNQVDPLRQLMETRNKLRDLMTKVDRSEEL
ENILEDVLNNTDNLAKLAGELDLGKKAKSDGTEGAE
 
Nucleotide Sequence: 531 bp     [Download]
>gi|262395299|ref|NC_013457.1|:19623-20153 Vibrio sp. Ex25 chromosome 2, complete genome
ATGACGAGTATCCACTCGAAACTGTCACGAGTACGGAAGCCTCGTGTCCACATTACCTATGATGTTGAAA
CTGAAGGTACAACTCTTAAGAAAGAGCTACCTTTTGTTGTAGGTGTAATGGGTGACTTCGCTGGTCAAAA
CACTGAAGCGTTGAAGCCATTGAAAGACCGCCGTTTTATTCAGATCGATCGAGACAACTTCGATGATGTG
CTCAAAAAGATGAACCCATCGGTTAAGTTCAAAGTTGCGAACAAGCTTGCGAACGACGATTCACAGTTTG
AGGTTGATTTGAACTTTAAATCAATGCAAGACTTTGAGCCCGCTGCGATCGTAAATCAAGTTGATCCACT
GCGCCAACTGATGGAAACGCGTAATAAACTGCGTGATTTGATGACAAAAGTTGACCGTTCTGAAGAGCTT
GAAAACATCTTAGAGGATGTTTTGAACAACACAGACAATCTGGCAAAACTTGCGGGCGAGTTAGATCTTG
GCAAGAAAGCGAAGTCAGACGGTACTGAAGGAGCGGAATAA