SecReT6
Protein ID: 262395320
SecReT6 ID370
T6SS typei5
Gene symbol-
Locus tagVEA_000021
StrainVibrio sp. Ex25
Repliconchromosome II [GenBank: NC_013457] [Browse all T6SS(s) in this replicon]
Location [Strand]20153..21646 [+]
Producthypothetical protein
NoteTssC
UniProt IDD0MCJ4
KEGG IDvex:VEA_000021
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 9.30E-186, Aligned region: 63..493
Protein Sequence: 497 a.a.     [Download]
>gi|262395320|ref|YP_003287173.1| hypothetical protein VEA_000021 [Vibrio sp. Ex25]
MTTEAEKQLDPTVNEQTTSFLDQAIGATKQTEASRAEELIKTLTEEAMKGTVTWNKNLTVTFREAINLLD
KQISDQLSEVMHHPELQKLEGSWRGLNYLVMNSETSSTLKIRMMSMTKKELHKDLSKAVEFDQSQIFKKV
YESEFGSAGGEPYGALIGDYEFTNHPEDIESLRLMSNVAASGFSPFLSAASPALFGFDEWTELSKPRDLD
KVFESLEYAQWRSFRESADSRFVSLTMPKVLARLPYGQATAPVEEFGFEEFEVDPVSGIAVNAEHNDYCW
MNSSYVLGVKLTDAFSKYGFCTAIRGAEGGGRVDNLPTHFFMSDDGDPDMKCPTEIGITDRREAELGKLG
FLPLCHYKNTNYAVFFGAQTCQKPANHESPEATANAAISARLPYMMATSRFAHYLKVMARDKIGSFMEAE
DVESWLNRWILGYVNASEGGGQEIRAKYPLADARVQVKEIPGAPGSYNAVAWLKPWLQMEELTTSLRLVA
KIPQSGG
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|262395299|ref|NC_013457.1|:20153-21646 Vibrio sp. Ex25 chromosome 2, complete genome
ATGACGACTGAAGCTGAAAAGCAGTTAGATCCAACTGTTAATGAACAAACAACTTCATTTTTAGATCAAG
CTATTGGTGCAACTAAGCAGACAGAAGCCTCTCGTGCTGAAGAGCTAATTAAAACGCTCACTGAAGAAGC
GATGAAAGGGACGGTTACTTGGAACAAAAACCTAACGGTAACTTTTCGTGAAGCGATTAATTTACTTGAT
AAACAGATTTCTGATCAGTTGTCTGAAGTAATGCATCATCCTGAATTACAGAAGCTTGAAGGTTCTTGGC
GTGGTTTAAATTATCTAGTGATGAACTCAGAGACGAGCTCTACTCTGAAAATTCGCATGATGAGTATGAC
TAAGAAAGAGTTACATAAAGACTTGAGTAAAGCGGTTGAATTTGACCAAAGCCAGATCTTTAAGAAAGTT
TACGAGTCTGAGTTTGGCAGTGCAGGTGGTGAACCTTATGGTGCATTAATTGGTGACTATGAGTTTACCA
ACCACCCAGAGGATATTGAGTCGCTGCGCCTAATGTCAAATGTAGCCGCTTCAGGCTTCTCCCCATTCTT
GTCCGCGGCCTCACCAGCACTATTTGGCTTTGATGAGTGGACTGAACTGTCAAAACCACGCGATCTAGAC
AAGGTCTTTGAGTCGCTAGAATACGCTCAATGGCGTTCGTTCCGTGAGAGTGCTGATTCACGTTTTGTTA
GCCTGACTATGCCGAAAGTTCTGGCTCGTTTGCCATACGGACAAGCCACTGCTCCAGTTGAGGAATTTGG
ATTTGAAGAGTTCGAAGTAGATCCAGTGTCAGGTATTGCTGTCAATGCTGAGCATAATGACTACTGTTGG
ATGAACTCTTCGTATGTTCTTGGTGTTAAGTTAACAGACGCCTTCTCAAAATATGGATTCTGTACAGCTA
TCCGTGGTGCAGAAGGTGGTGGTCGAGTGGATAATTTGCCAACACATTTCTTCATGAGTGATGATGGCGA
TCCTGATATGAAGTGTCCAACAGAGATTGGTATTACCGACCGACGTGAGGCAGAGCTGGGTAAACTTGGT
TTCTTACCGCTTTGTCACTACAAAAACACCAACTATGCGGTGTTCTTTGGTGCGCAAACCTGTCAAAAAC
CGGCGAACCACGAATCTCCAGAAGCAACGGCTAATGCGGCGATTTCAGCACGTCTACCTTACATGATGGC
GACATCTCGTTTTGCGCATTATTTGAAGGTAATGGCTCGAGATAAAATCGGTAGCTTTATGGAAGCAGAA
GACGTTGAGTCTTGGTTGAACCGCTGGATTCTAGGCTATGTAAATGCTTCAGAGGGTGGTGGTCAAGAGA
TCCGAGCGAAATACCCTCTAGCAGATGCTCGTGTCCAGGTTAAGGAAATCCCTGGCGCACCAGGTTCTTA
CAATGCTGTAGCATGGCTTAAGCCTTGGCTGCAAATGGAAGAATTGACGACATCTTTGCGACTTGTTGCA
AAGATCCCTCAGTCGGGTGGATAA