SecReT6
Protein ID: 262395321
SecReT6 ID370
T6SS typei5
Gene symbol-
Locus tagVEA_000022
StrainVibrio sp. Ex25
Repliconchromosome II [GenBank: NC_013457] [Browse all T6SS(s) in this replicon]
Location [Strand]21711..23210 [+]
Producthypothetical protein
NoteTssC
UniProt IDD0MCJ5
KEGG IDvex:VEA_000022
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 9.00E-166, Aligned region: 61..493
Protein Sequence: 499 a.a.     [Download]
>gi|262395321|ref|YP_003287174.1| hypothetical protein VEA_000022 [Vibrio sp. Ex25]
MSLNFRDPSKLKHEFSTGGHAELDSPWLTRFNESSDLVEAARIWLEGTRSRDLDSFRHSVMNTINRIDEL
LESQLNEIIHHPEFQQLERGWIGVRYLCEQVDTRSSDSVKVKVLAATWNEVSKDALKAIEFDQSALFKLL
YQNEYGMAGGEPFGVVVGDYQLRCDASKNYFDRDLSVLSKISQSAAAAFSPFIMSASPEMFGVDSFSQLS
AIRDIAAQFEQADYAKWRSLRDNDDTKFIGLTAPNVLFRQPYKSDGSRNDQFDFQEHVYDSNRDLLWGSS
AYCFAAVSIRAFREHGWFTHMRGIKQGDYSQGIIVAPTRNKMRVNGKNDRERCPLNLKISERKEQELSEC
GFISISPVPETDMVGMTSNVSLYKPKQYAEKHISTNAKLTSMLQYTLCVSRVAHYLKVMGRDKIGGYQDA
ESLERDFQRWLHQYTTASDEASDELRAKYPLNEAKITVREKRETPGHYYSVIHLRPHFQLDQMVSSIKLI
TELSPEHLV
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|262395299|ref|NC_013457.1|:21711-23210 Vibrio sp. Ex25 chromosome 2, complete genome
GTGTCACTTAACTTTCGCGATCCCAGTAAGCTAAAGCATGAATTCAGCACAGGAGGCCATGCTGAGCTTG
ATAGCCCGTGGTTGACTCGATTCAATGAATCTTCTGATCTTGTAGAGGCAGCTCGAATTTGGCTAGAAGG
TACGCGTTCAAGAGATTTGGACAGTTTTCGTCATAGTGTGATGAACACGATAAACCGAATTGATGAGCTA
TTAGAGTCTCAATTAAACGAAATAATACATCATCCTGAGTTTCAACAACTCGAAAGAGGTTGGATCGGCG
TGAGGTATTTATGCGAACAGGTCGACACTCGCTCATCAGACTCCGTCAAAGTCAAGGTGTTGGCGGCAAC
ATGGAATGAAGTCAGTAAAGATGCACTAAAAGCCATCGAATTTGACCAATCAGCACTATTTAAGCTGCTC
TATCAAAATGAATATGGCATGGCCGGGGGAGAACCCTTTGGCGTGGTAGTTGGCGATTATCAACTTCGTT
GTGATGCGAGTAAAAATTATTTTGATAGAGATCTGTCTGTGCTCAGCAAGATCTCTCAGTCTGCAGCGGC
AGCATTCAGCCCGTTCATTATGTCAGCATCGCCGGAGATGTTTGGTGTTGACAGTTTTTCACAGCTCTCT
GCGATAAGAGATATTGCGGCCCAATTTGAACAGGCAGACTACGCAAAATGGCGCAGTTTGAGAGACAACG
ATGATACCAAATTTATTGGCCTGACTGCGCCGAATGTTTTATTCCGTCAGCCATATAAAAGTGATGGTTC
GCGCAACGATCAGTTCGACTTTCAAGAGCATGTCTACGATTCTAATCGCGATTTGCTATGGGGGAGTAGC
GCGTATTGTTTTGCGGCCGTATCAATTAGAGCGTTTCGGGAGCATGGGTGGTTTACGCACATGCGAGGCA
TTAAGCAAGGGGATTATAGTCAGGGCATTATCGTCGCTCCTACTAGGAACAAAATGCGTGTTAATGGCAA
GAATGACCGTGAAAGATGCCCTTTAAACTTAAAGATCTCTGAGAGAAAAGAGCAAGAGTTGTCTGAATGC
GGTTTCATTTCTATTTCTCCTGTACCTGAAACCGATATGGTAGGGATGACCTCGAATGTATCTCTCTACA
AGCCTAAGCAATATGCAGAAAAACACATTTCAACGAATGCAAAGCTCACGTCGATGTTGCAATACACGTT
GTGTGTGTCGCGAGTTGCACATTATCTCAAGGTTATGGGGCGTGACAAGATTGGTGGGTATCAAGATGCA
GAAAGCCTAGAGCGAGACTTTCAACGATGGTTGCATCAGTACACTACCGCGTCGGATGAAGCATCTGATG
AACTTAGGGCGAAGTACCCCTTAAATGAAGCGAAAATTACGGTTCGAGAGAAAAGAGAAACTCCAGGACA
CTATTACTCTGTTATCCATTTGCGACCGCACTTCCAGCTCGATCAAATGGTATCTAGCATTAAATTAATT
ACTGAATTATCACCAGAGCACTTGGTGTAA