SecReT6
Protein ID: 262395322
SecReT6 ID370
T6SS typei5
Gene symbol-
Locus tagVEA_000023
StrainVibrio sp. Ex25
Repliconchromosome II [GenBank: NC_013457] [Browse all T6SS(s) in this replicon]
Location [Strand]23221..24015 [+]
Productprotein of avirulence locus ImpE
NoteTagJ
UniProt IDD0MCJ6
KEGG IDvex:VEA_000023
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 1.00E-40, Aligned region: 137..257
TPR_19 [PF14559], Evalue: 0.0066, Aligned region: 7..63
TPR_19 [PF14559], Evalue: 0.0066, Aligned region: 109..121
Protein Sequence: 264 a.a.     [Download]
>gi|262395322|ref|YP_003287175.1| protein of avirulence locus ImpE [Vibrio sp. Ex25]
MTQWKNALSQGQLQQALKLLIDEIKAAPKDASLRSSFIELLCIDGDFERADEQLMQSIKLFPEYLPGASQ
LRHLVKAAQARKDFIDGAASAKVLGDEEFTKELVRFNLALKNQDYAEASHLAHSIEEHRTIKGFNINGTN
YEDARDIDDRLGGYIELFSTAGNYFLVPISSIQALEIKAPTSLLESIWRPVEFDIDGLGEGEGHMPLTYV
DSETDAQKLGRETDWKQLGEQESFVGLGQKCWLVGDSALPICDLTTLLESKQIA
 
Nucleotide Sequence: 795 bp     [Download]
>gi|262395299|ref|NC_013457.1|:23221-24015 Vibrio sp. Ex25 chromosome 2, complete genome
ATGACCCAATGGAAAAATGCTTTGTCCCAAGGCCAATTGCAACAAGCTCTAAAGCTATTAATTGATGAAA
TTAAAGCGGCGCCTAAAGATGCAAGCTTGAGAAGCTCGTTCATTGAGCTGCTTTGCATTGATGGAGACTT
CGAGCGTGCGGATGAGCAACTTATGCAATCGATCAAATTGTTTCCTGAGTATCTACCTGGTGCAAGTCAG
TTGCGACATTTAGTGAAAGCGGCCCAGGCTAGAAAAGATTTTATCGACGGTGCGGCTAGTGCCAAGGTAT
TAGGTGACGAGGAATTCACTAAAGAGCTTGTTCGCTTTAACCTCGCTCTCAAAAATCAAGACTATGCAGA
AGCGTCACACCTAGCGCATAGCATTGAAGAGCATCGCACTATTAAAGGCTTTAACATAAACGGTACAAAT
TATGAAGATGCTAGGGATATTGATGATCGTTTAGGTGGTTACATTGAACTGTTTTCCACCGCGGGTAACT
ATTTTCTTGTTCCAATTTCTAGCATTCAAGCGCTAGAAATAAAAGCACCTACCTCTTTATTAGAAAGTAT
TTGGCGACCTGTAGAGTTTGATATTGACGGACTTGGCGAAGGAGAAGGCCATATGCCATTGACCTATGTT
GACTCAGAAACTGACGCACAAAAGCTAGGTCGAGAAACAGATTGGAAACAGCTTGGTGAGCAAGAATCCT
TCGTGGGTTTAGGCCAAAAATGTTGGCTAGTTGGTGATTCAGCCCTCCCAATCTGTGACTTGACTACATT
GTTAGAATCGAAACAAATAGCGTAA