SecReT6
Protein ID: 262395323
SecReT6 ID370
T6SS typei5
Gene symbol-
Locus tagVEA_000024
StrainVibrio sp. Ex25
Repliconchromosome II [GenBank: NC_013457] [Browse all T6SS(s) in this replicon]
Location [Strand]24023..24487 [+]
Producthypothetical protein
NoteTssE
UniProt IDD0MCJ7
KEGG IDvex:VEA_000024
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 5.80E-19, Aligned region: 27..129
Protein Sequence: 154 a.a.     [Download]
>gi|262395323|ref|YP_003287176.1| hypothetical protein VEA_000024 [Vibrio sp. Ex25]
MSLTVSLLDKLMDSDPSTRDEKDFPTSQQQMLNSLLRDLESMLNSRIGWKNIPDDLLEVRYSILNYGLPD
FSSMPYSSQEGQNQLCDIVHDAIKEFEPRLRNPYVQISDEKNAIDRVLRLQISATCLIDNSIHEVRFNSE
VEPVNLGMKLSRAK
 
Nucleotide Sequence: 465 bp     [Download]
>gi|262395299|ref|NC_013457.1|:24023-24487 Vibrio sp. Ex25 chromosome 2, complete genome
ATGTCTTTAACCGTTTCTCTGCTCGACAAATTGATGGATAGTGATCCTTCAACTAGAGATGAAAAAGACT
TCCCTACGAGCCAACAACAGATGTTGAACAGCTTGCTTAGAGATCTGGAGTCTATGTTAAATAGTCGTAT
CGGATGGAAAAACATTCCTGATGACCTTTTAGAGGTTCGCTATTCAATATTGAATTATGGTCTGCCAGAT
TTTTCCTCGATGCCTTATAGCAGCCAAGAGGGGCAGAATCAGCTTTGTGACATTGTTCATGATGCAATTA
AAGAGTTCGAGCCTAGGTTAAGGAATCCTTATGTCCAGATTTCGGACGAGAAAAACGCTATTGATAGGGT
GTTGAGGTTACAAATTAGCGCCACTTGCTTAATCGATAACAGCATTCATGAAGTGCGATTCAATTCTGAA
GTAGAGCCGGTAAATTTAGGTATGAAACTGAGTAGAGCGAAATGA