SecReT6
Protein ID: 262395324
SecReT6 ID370
T6SS typei5
Gene symbol-
Locus tagVEA_000025
StrainVibrio sp. Ex25
Repliconchromosome II [GenBank: NC_013457] [Browse all T6SS(s) in this replicon]
Location [Strand]24484..26307 [+]
Productprotein ImpG/VasA
NoteTssF
UniProt IDD0MCJ8
KEGG IDvex:VEA_000025
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.00E-190, Aligned region: 5..607
Protein Sequence: 607 a.a.     [Download]
>gi|262395324|ref|YP_003287177.1| protein ImpG/VasA [Vibrio sp. Ex25]
MSEEFLKYYNRELAYLRHKGQEFGEQYPKIAARLRISEEQVDDPHVERLLEGCAFLTARIRQSLDNSYPQ
FTESLMGQLYPDFHAPIPSMSVIKMNCSSSTSSFFDVEEGERVVIGAPGYHECEFRTCYPVRMYPVDVTS
GAFKNAPLKSVGSQWESHAHSVLKIQLTAQDEETSLSDMGLERLRFYLNGHSQLTFKLYQMLFQNLIGLS
VVAGGKEVRSLTKRHLIEVGFSEDEKVVPYSKRSFSGARLLVEYLHFPEKFMFFDITELGLSELALGEQA
ELYFYFDTNDDWLPKQVDEESLMVGCVPVVNLFKSVMEPKRILPTEYDYHLSPQYQEAESNEVVSISDVT
LRNWNKTYHNLPCYHAGEHTHYMNASEIYWLMRREDKNWAGGYDEPGRETYISFVDKRHQLFSPESRENW
LMYVEAECCNRNLAQKLPFGGGLPKVSLPEVNDNFESVRCLVSISETLRPEMDESTRWQLTKLLTLNHFT
EEDGLTTLKQTLNLYAFSGTAETKAVIDALAKLEFEPTTGRVSQKGKVGFAHGIKIILTVSDQILPKEQI
FLLGSVLSVYFAQYAEINIFTQLEIRLKSTGKPFHLWPALTGDKVLL
 
Nucleotide Sequence: 1824 bp     [Download]
>gi|262395299|ref|NC_013457.1|:24484-26307 Vibrio sp. Ex25 chromosome 2, complete genome
ATGAGTGAAGAGTTTCTCAAATACTATAATCGCGAGTTAGCTTATTTACGTCACAAAGGACAAGAGTTTG
GGGAGCAGTATCCTAAGATCGCTGCGAGACTCCGTATCAGTGAGGAGCAGGTTGACGATCCACATGTAGA
AAGATTGCTAGAAGGCTGTGCATTTCTAACGGCAAGGATTAGACAAAGTTTAGACAATAGTTATCCTCAG
TTCACTGAATCTTTGATGGGGCAGTTATATCCGGATTTTCACGCACCAATTCCATCAATGTCCGTCATTA
AGATGAACTGCTCTAGCTCCACTTCCTCTTTTTTTGACGTAGAAGAAGGTGAGCGAGTCGTTATCGGTGC
TCCTGGATACCACGAATGCGAGTTTAGAACCTGTTATCCGGTCAGAATGTACCCTGTTGATGTGACCTCT
GGCGCTTTCAAAAACGCACCGCTTAAATCGGTGGGCTCCCAATGGGAAAGCCATGCTCATTCAGTTTTGA
AAATCCAGCTCACCGCCCAAGATGAAGAGACATCTCTGAGTGACATGGGATTAGAACGGTTGCGCTTTTA
TTTAAACGGGCACTCTCAGTTGACGTTTAAACTTTACCAAATGCTATTTCAAAATCTAATTGGTTTATCT
GTCGTTGCGGGTGGCAAAGAAGTTCGTTCTTTAACGAAAAGGCATCTTATTGAAGTGGGATTTTCAGAAG
ATGAGAAGGTTGTTCCATACAGTAAGAGAAGCTTTTCGGGAGCAAGATTACTTGTTGAGTATCTGCACTT
TCCTGAGAAGTTCATGTTCTTTGATATCACTGAACTCGGATTATCAGAACTAGCTCTTGGAGAGCAAGCT
GAACTGTATTTTTACTTTGATACCAATGATGATTGGCTTCCTAAGCAAGTGGATGAAGAGAGCTTGATGG
TTGGTTGTGTACCAGTGGTCAACTTATTTAAAAGTGTTATGGAGCCCAAGCGTATTCTACCAACCGAGTA
CGATTACCACTTATCACCGCAATACCAGGAAGCCGAGAGTAACGAGGTTGTCTCTATTTCTGACGTAACA
TTGAGAAACTGGAACAAAACGTATCACAACCTGCCATGTTATCACGCTGGTGAGCACACGCATTATATGA
ACGCCAGTGAAATTTATTGGTTGATGAGACGTGAGGATAAAAACTGGGCTGGTGGATACGATGAGCCGGG
CAGGGAAACTTACATTTCTTTTGTTGATAAAAGGCATCAATTGTTCAGTCCAGAGAGCCGAGAAAACTGG
TTAATGTACGTTGAAGCTGAGTGCTGCAATCGTAATTTAGCGCAGAAGCTTCCATTTGGAGGCGGTCTTC
CAAAAGTCTCTTTGCCGGAAGTAAATGACAACTTCGAGTCAGTTCGTTGTTTAGTTTCTATATCAGAAAC
CCTCCGGCCAGAAATGGATGAAAGTACACGATGGCAGCTAACTAAGCTTCTAACTTTAAACCACTTTACC
GAAGAAGATGGATTAACAACTTTGAAGCAAACTCTGAATCTCTACGCGTTTTCTGGGACCGCAGAAACGA
AAGCGGTAATTGATGCTTTAGCGAAGCTAGAGTTCGAGCCGACTACAGGTAGAGTCAGTCAGAAAGGTAA
AGTTGGTTTTGCGCACGGTATAAAAATCATTTTGACGGTTTCTGATCAAATTTTACCTAAAGAGCAAATC
TTCCTCCTAGGTAGTGTGCTATCCGTTTACTTTGCACAATATGCTGAAATTAACATTTTTACGCAGCTAG
AAATAAGACTTAAGTCAACGGGAAAGCCCTTCCACTTATGGCCTGCATTAACTGGCGATAAGGTGTTGCT
ATGA