SecReT6
Protein ID: 262395325
SecReT6 ID370
T6SS typei5
Gene symbol-
Locus tagVEA_000026
StrainVibrio sp. Ex25
Repliconchromosome II [GenBank: NC_013457] [Browse all T6SS(s) in this replicon]
Location [Strand]26304..27269 [+]
Producthypothetical protein
NoteTssG
UniProt IDD0MCJ9
KEGG IDvex:VEA_000026
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.20E-74, Aligned region: 9..307
Protein Sequence: 321 a.a.     [Download]
>gi|262395325|ref|YP_003287178.1| hypothetical protein VEA_000026 [Vibrio sp. Ex25]
MIAEQFYRDLKQHPLFEAIHLIEHEILQAEAQIGTDALPKHEKLHLKVNPSLGFENAQLCDLKHIDSHKL
ALETNLIGLTGEQGVLPQHYSELALHRQKEGDTAMVDFYDIFNHRLLSLYYRCWQLSQLTVQSRAHAQGL
RSPLEDCKSALTGQGSSLSLHYGGVFASPTRSKAGLKSVLECLSGCQVKIHEFQGQWLHLAKEEQTRLSS
RTMPEGQFAQLGSGASLGSKAWNINAGTTIEFLPKHKGLVSKLLPNHPNVEIIKRAAYEFIGKHKQVKWQ
LTTKHSLLPQVCLSKKHGQLGVGSVLKKHKRTKDRTITITI
 
Nucleotide Sequence: 966 bp     [Download]
>gi|262395299|ref|NC_013457.1|:26304-27269 Vibrio sp. Ex25 chromosome 2, complete genome
ATGATCGCGGAGCAATTTTATCGAGATCTAAAGCAACATCCGTTGTTTGAAGCAATTCACCTTATCGAAC
ACGAGATCTTGCAAGCCGAGGCACAAATAGGGACAGATGCTCTACCGAAGCATGAAAAACTACACTTAAA
GGTCAATCCATCGTTAGGTTTTGAAAATGCGCAGCTTTGCGATCTAAAACATATTGATAGCCACAAGCTA
GCTCTTGAAACCAATTTAATAGGCCTAACGGGTGAGCAGGGGGTGCTTCCTCAGCACTACAGCGAGTTAG
CTTTGCATCGTCAAAAAGAAGGCGATACGGCAATGGTGGACTTCTACGATATTTTTAACCATCGTTTACT
ATCTCTTTACTATCGATGCTGGCAACTGAGTCAATTGACCGTTCAGTCTCGTGCTCATGCACAGGGATTA
CGTTCACCTTTAGAAGATTGTAAGTCGGCATTAACTGGCCAGGGTAGTTCGTTGTCCCTGCATTATGGTG
GTGTTTTTGCTTCACCGACGAGAAGCAAAGCTGGACTAAAAAGTGTTCTTGAATGTTTATCTGGATGCCA
AGTAAAGATTCATGAGTTTCAAGGGCAGTGGCTACATCTTGCAAAAGAAGAGCAAACACGTCTTTCATCT
CGAACTATGCCAGAAGGGCAGTTTGCTCAACTTGGTTCCGGAGCATCCTTAGGCTCGAAAGCTTGGAATA
TAAACGCAGGAACAACGATCGAGTTTCTGCCAAAGCACAAAGGTCTGGTTAGTAAATTACTGCCTAACCA
TCCAAATGTAGAAATTATTAAACGTGCGGCTTATGAATTTATTGGTAAGCATAAGCAAGTGAAATGGCAG
CTCACCACCAAACATAGTTTATTACCTCAAGTTTGTTTATCAAAAAAACATGGTCAGTTAGGTGTTGGTT
CTGTACTTAAAAAACATAAACGCACAAAAGATCGAACCATAACAATTACTATTTAA