SecReT6
Protein ID: 262395326
SecReT6 ID370
T6SS typei5
Gene symbol-
Locus tagVEA_000027
StrainVibrio sp. Ex25
Repliconchromosome II [GenBank: NC_013457] [Browse all T6SS(s) in this replicon]
Location [Strand]27280..29847 [+]
ProductClpB protein
NoteTssH
UniProt IDD0MCK0
KEGG IDvex:VEA_000027
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.80E-39, Aligned region: 213..233
AAA_2 [PF07724], Evalue: 2.80E-39, Aligned region: 587..753
AAA [PF00004], Evalue: 7.10E-21, Aligned region: 213..344
AAA [PF00004], Evalue: 7.10E-21, Aligned region: 593..711
AAA [PF00004], Evalue: 7.10E-21, Aligned region: 772..826
AAA_5 [PF07728], Evalue: 6.40E-13, Aligned region: 213..289
AAA_5 [PF07728], Evalue: 6.40E-13, Aligned region: 592..713
AAA_16 [PF13191], Evalue: 1.00E-11, Aligned region: 190..233
AAA_16 [PF13191], Evalue: 1.00E-11, Aligned region: 256..291
AAA_16 [PF13191], Evalue: 1.00E-11, Aligned region: 492..518
AAA_16 [PF13191], Evalue: 1.00E-11, Aligned region: 561..624
AAA_16 [PF13191], Evalue: 1.00E-11, Aligned region: 657..686
AAA_16 [PF13191], Evalue: 1.00E-11, Aligned region: 750..788
ClpB_D2-small [PF10431], Evalue: 2.70E-11, Aligned region: 760..834
Sigma54_activat [PF00158], Evalue: 1.30E-08, Aligned region: 209..253
Sigma54_activat [PF00158], Evalue: 1.30E-08, Aligned region: 573..710
AAA_22 [PF13401], Evalue: 2.40E-08, Aligned region: 212..294
AAA_22 [PF13401], Evalue: 2.40E-08, Aligned region: 330..385
AAA_22 [PF13401], Evalue: 2.40E-08, Aligned region: 590..627
AAA_14 [PF13173], Evalue: 1.80E-07, Aligned region: 213..324
AAA_14 [PF13173], Evalue: 1.80E-07, Aligned region: 590..680
AAA_19 [PF13245], Evalue: 1.20E-06, Aligned region: 213..234
AAA_19 [PF13245], Evalue: 1.20E-06, Aligned region: 586..615
IstB_IS21 [PF01695], Evalue: 5.60E-06, Aligned region: 207..236
IstB_IS21 [PF01695], Evalue: 5.60E-06, Aligned region: 591..625
AAA_18 [PF13238], Evalue: 5.20E-05, Aligned region: 213..278
AAA_18 [PF13238], Evalue: 5.20E-05, Aligned region: 464..506
AAA_18 [PF13238], Evalue: 5.20E-05, Aligned region: 593..631
AAA_25 [PF13481], Evalue: 5.50E-05, Aligned region: 213..286
AAA_25 [PF13481], Evalue: 5.50E-05, Aligned region: 588..614
AAA_25 [PF13481], Evalue: 5.50E-05, Aligned region: 655..676
NTPase_1 [PF03266], Evalue: 0.00011, Aligned region: 213..233
NTPase_1 [PF03266], Evalue: 0.00011, Aligned region: 592..630
AAA_17 [PF13207], Evalue: 0.00011, Aligned region: 213..281
AAA_17 [PF13207], Evalue: 0.00011, Aligned region: 591..627
AAA_29 [PF13555], Evalue: 0.00012, Aligned region: 151..165
AAA_29 [PF13555], Evalue: 0.00012, Aligned region: 205..229
AAA_29 [PF13555], Evalue: 0.00012, Aligned region: 586..603
Zeta_toxin [PF06414], Evalue: 0.00025, Aligned region: 213..233
Zeta_toxin [PF06414], Evalue: 0.00025, Aligned region: 584..633
RuvB_N [PF05496], Evalue: 0.00038, Aligned region: 211..232
RuvB_N [PF05496], Evalue: 0.00038, Aligned region: 280..293
RuvB_N [PF05496], Evalue: 0.00038, Aligned region: 545..613
RuvB_N [PF05496], Evalue: 0.00038, Aligned region: 660..686
RuvB_N [PF05496], Evalue: 0.00038, Aligned region: 821..848
T2SE [PF00437], Evalue: 0.00045, Aligned region: 204..233
T2SE [PF00437], Evalue: 0.00045, Aligned region: 579..624
NACHT [PF05729], Evalue: 0.00054, Aligned region: 213..240
NACHT [PF05729], Evalue: 0.00054, Aligned region: 592..613
UPF0079 [PF02367], Evalue: 0.00079, Aligned region: 213..233
UPF0079 [PF02367], Evalue: 0.00079, Aligned region: 579..621
Arch_ATPase [PF01637], Evalue: 0.00082, Aligned region: 192..233
Arch_ATPase [PF01637], Evalue: 0.00082, Aligned region: 586..624
TIP49 [PF06068], Evalue: 0.001, Aligned region: 213..234
TIP49 [PF06068], Evalue: 0.001, Aligned region: 282..291
TIP49 [PF06068], Evalue: 0.001, Aligned region: 560..628
RNA_helicase [PF00910], Evalue: 0.0034, Aligned region: 214..234
RNA_helicase [PF00910], Evalue: 0.0034, Aligned region: 593..616
RNA_helicase [PF00910], Evalue: 0.0034, Aligned region: 693..711
Clp_N [PF02861], Evalue: 0.0035, Aligned region: 24..75
Clp_N [PF02861], Evalue: 0.0035, Aligned region: 106..125
DUF258 [PF03193], Evalue: 0.0049, Aligned region: 209..232
DUF258 [PF03193], Evalue: 0.0049, Aligned region: 575..603
DUF815 [PF05673], Evalue: 0.0051, Aligned region: 208..288
DUF815 [PF05673], Evalue: 0.0051, Aligned region: 571..617
Protein Sequence: 855 a.a.     [Download]
>gi|262395326|ref|YP_003287179.1| ClpB protein [Vibrio sp. Ex25]
MASLSLSALVERLSPQAKETLEQAAAMASSRTHHSIEMSHWLMTIIQHPADIYSEVFDEFDVDKIKVETD
LQKTLEKYKTGCQSVPGLSAHTVTVMQNALLSATIEFNQEQLDCIHLLFAYLSDDTLVNMAGSISPELNK
IEPSRLLNFKESNTRQSGSNDLGKSNANSALNQFTTDLTEQAREGKIDPVIGRDNEIRLMIDILLRRRQN
NPILTGEAGVGKTAVVEGLAQKIIDGDVPPALQNVAIKSLDLALLQAGAGMKGEFENRLKNLVKEVNDAP
QPIILFIDEAHGLIGGGGQAGQGDAANILKPALARGELRTIAATTWAEYKKYFEKDAALTRRFQVVKVDE
PAPDLAIEMLRGLLDVMAQHHDVHITSQALNAAVQLSARYINGRQLPDKAVSVLDTACSRVALSQSSTPG
GLDAKRNKLKAKQAEYEHLSQESQLGAPLDMQLQDVRKEIDVLSSEIVELETLWEKEKEWVSEAKSLRAQ
IIKEGSETARDKLQELESSLSANSQPLVFSHVNEALIAEVISDWTGIPLGKLQDDEIQAVLSLKESLCKR
VVGQEHALEVMSEVIKTASAQLTDETRPNGVFLLTGPSGVGKTESALAIAEKVYGSEENVTTINMSEFKE
EHKVSLLLGSPPGYVGYGEGGVLTEAVRRKPYSVILLDEMEKAHPGVQDIFYQVFDKGSIKDGEGRDIDF
KNTIIIMTANTGTETTMSLYSDPDLSPEPSALKDALRDDLLVDFKPAFLGRVNVLPYLPLSREVLIEITK
LKLAKVTNRIRKNYGADLFFDEELINDIVDNSNESGSGARVVQTTIENTLLPKISHEILHAILNDKTFDE
IIVKGTTSGLDVSIV
 
Nucleotide Sequence: 2568 bp     [Download]
>gi|262395299|ref|NC_013457.1|:27280-29847 Vibrio sp. Ex25 chromosome 2, complete genome
ATGGCTTCACTCTCACTTTCAGCGTTGGTCGAAAGATTGTCTCCTCAGGCTAAGGAAACACTTGAACAAG
CAGCTGCGATGGCAAGCTCTCGAACCCATCACAGTATTGAAATGTCTCACTGGTTAATGACGATTATTCA
ACATCCTGCCGATATTTACTCGGAAGTTTTCGACGAATTTGATGTCGATAAAATCAAGGTTGAAACTGAT
CTTCAAAAGACACTTGAAAAATACAAAACGGGATGTCAATCGGTCCCAGGTCTTTCAGCTCACACAGTGA
CTGTGATGCAAAATGCTTTGCTATCGGCAACGATTGAGTTCAATCAGGAGCAGTTGGATTGCATTCATCT
TTTATTTGCCTACTTGTCTGATGATACGTTAGTCAACATGGCTGGTTCGATTAGCCCTGAGTTAAACAAG
ATAGAACCATCTCGGTTATTGAACTTTAAAGAAAGTAATACGCGTCAATCAGGATCGAATGACCTAGGGA
AATCAAACGCGAATTCTGCGCTGAATCAATTTACAACAGATCTTACTGAGCAGGCTAGGGAAGGTAAGAT
AGATCCAGTTATTGGTAGAGACAATGAAATCCGTTTAATGATCGACATCTTATTAAGACGTCGACAAAAC
AACCCGATTCTAACTGGTGAAGCTGGCGTTGGAAAAACAGCCGTTGTTGAAGGCTTGGCGCAAAAGATTA
TCGATGGCGATGTACCTCCTGCTCTACAAAATGTAGCGATTAAGTCTTTGGATCTGGCGTTATTGCAAGC
TGGTGCTGGCATGAAAGGTGAGTTTGAAAACAGACTTAAAAACCTTGTGAAAGAAGTTAACGACGCACCA
CAACCCATTATTTTGTTTATCGATGAAGCACATGGTCTGATTGGTGGTGGGGGACAAGCAGGACAAGGTG
ATGCAGCGAATATTCTAAAGCCAGCGTTAGCGAGAGGTGAACTCAGAACGATCGCAGCAACAACTTGGGC
AGAATATAAAAAGTATTTTGAAAAAGACGCGGCTCTTACCAGACGCTTTCAAGTAGTGAAGGTCGACGAG
CCAGCGCCGGATCTAGCGATCGAGATGTTACGTGGTTTACTTGACGTAATGGCACAACACCATGACGTCC
ACATCACTAGCCAGGCTCTCAATGCTGCCGTTCAACTCTCAGCTCGATACATTAATGGCCGACAACTGCC
AGATAAGGCTGTGTCTGTTTTAGACACAGCCTGCTCGCGAGTCGCGTTAAGTCAATCGTCTACACCGGGA
GGTCTAGATGCGAAAAGGAATAAACTAAAAGCCAAGCAAGCTGAATATGAGCACCTAAGCCAAGAAAGTC
AGCTAGGTGCACCTCTTGATATGCAGTTGCAAGATGTCAGAAAAGAGATTGATGTTCTATCTAGTGAAAT
AGTTGAACTAGAGACGCTGTGGGAGAAAGAAAAAGAGTGGGTAAGTGAAGCTAAGTCACTTAGAGCTCAA
ATAATCAAGGAGGGTTCTGAGACTGCTAGGGACAAGTTACAGGAGCTCGAAAGTAGCCTCTCCGCTAACT
CGCAACCATTAGTATTTTCGCATGTCAATGAAGCGCTTATTGCAGAAGTAATTTCAGATTGGACCGGGAT
ACCACTGGGCAAACTTCAGGATGATGAAATCCAAGCTGTACTGAGTTTGAAAGAGAGTTTGTGTAAACGA
GTTGTCGGACAGGAGCACGCTTTGGAAGTCATGTCTGAAGTGATAAAAACTGCCAGTGCACAGCTCACTG
ATGAGACACGACCAAATGGTGTATTTCTTCTCACGGGACCAAGTGGAGTGGGTAAAACTGAATCTGCTTT
AGCTATTGCAGAGAAAGTGTACGGCAGTGAAGAGAATGTCACAACTATCAATATGTCCGAGTTTAAAGAA
GAGCACAAAGTTTCCTTATTATTAGGCTCGCCTCCAGGTTATGTTGGGTATGGCGAAGGTGGTGTACTTA
CTGAAGCCGTCAGACGCAAACCTTATAGTGTGATTCTTTTGGATGAAATGGAAAAAGCGCACCCTGGAGT
TCAAGATATTTTTTATCAGGTATTCGATAAAGGCTCAATTAAAGATGGTGAAGGTCGAGATATAGATTTT
AAAAACACTATTATTATTATGACCGCGAATACAGGGACCGAAACGACGATGTCTTTGTATTCTGATCCTG
ATTTATCTCCAGAACCTTCAGCACTAAAAGATGCTTTGCGTGACGATTTGTTGGTTGACTTTAAACCTGC
ATTTTTAGGGCGTGTTAATGTATTACCTTATTTGCCTCTATCAAGAGAAGTATTGATAGAAATAACAAAA
TTAAAATTAGCCAAAGTTACGAATCGCATTCGTAAAAATTACGGCGCTGACCTATTTTTTGATGAAGAAC
TAATTAATGATATTGTAGACAATAGTAATGAGTCGGGGAGCGGTGCACGTGTGGTACAGACAACCATAGA
AAACACATTACTTCCTAAGATTTCTCATGAAATATTGCATGCAATTCTTAATGATAAGACGTTTGATGAA
ATTATTGTTAAAGGTACAACTAGTGGACTTGATGTCTCAATAGTTTAA