SecReT6
Protein ID: 262395328
SecReT6 ID370
T6SS typei5
Gene symbol-
Locus tagVEA_000029
StrainVibrio sp. Ex25
Repliconchromosome II [GenBank: NC_013457] [Browse all T6SS(s) in this replicon]
Location [Strand]30584..32419 [+]
Producthypothetical protein
NoteTssI
UniProt IDD0MCK2
KEGG IDvex:VEA_000029
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.70E-63, Aligned region: 31..335
Phage_base_V [PF04717], Evalue: 7.60E-25, Aligned region: 377..470
Protein Sequence: 611 a.a.     [Download]
>gi|262395328|ref|YP_003287181.1| hypothetical protein VEA_000029 [Vibrio sp. Ex25]
MKRATQDNNFIRISSPFGKDAIILNSFEYKEEISELFSLRAKAYFNDQRSELNEIIGKEVTITLENSEDV
SSKPRYIHGYVSAARLEGQRVSNTHNGENYKNIELLIEPKLRFADYRKNCRIFQHKDIKEIISEVLSEHS
VAFSFELTKSYPKYTYKVQYEESDLEFVRRLLSEEGLSFCFTHTKSVHTLKIFDDISFYKPGTEFLVDFD
TGTAKSSHISSWHETQVLTTKASQKSGYNMLKPSSNPKNTAKGESDFFTVPESEYFEYMGETESDDQYAL
RNTHAIEALQQNAYLCRGEATCRTFSVGKCFKFKKHEDKSRVGKEYVLSAVFLSAAVYNQTGQGGTAAQG
VKVSFSCVDSKTILRPSVNYPKPQMKGLQTAVVTGNKDGEIYIDKHGRIKVQFHWDRVGKYDVNSSCWIR
VAQNIAGNGWGSVFHPRVGQEVIVEFVNGDPDQPIVTGSLYNGSQLPPYTLPEQSSQSGYKSRSVQKGTS
NFNELRFDDKPGEEHIYLHAEKLFQMLVEDCVDIAVENSKTEKVTNDVNQEIGKNATLKVGKNFSNETGE
VLSFNAGKSIEIKVGGASIQMSSSGEINIKGNKISINGSAIALKAGQISLN
 
Nucleotide Sequence: 1836 bp     [Download]
>gi|262395299|ref|NC_013457.1|:30584-32419 Vibrio sp. Ex25 chromosome 2, complete genome
ATGAAAAGAGCAACTCAAGATAACAATTTCATCCGAATTTCCTCTCCATTCGGAAAAGATGCCATCATAC
TAAACTCATTTGAGTATAAAGAAGAGATCTCAGAACTTTTTTCATTGCGTGCTAAAGCTTACTTTAATGA
TCAACGAAGTGAGTTAAACGAAATAATTGGTAAAGAAGTAACAATTACCCTTGAAAATAGTGAGGATGTT
TCTTCAAAACCTCGTTATATACATGGTTATGTATCTGCTGCAAGATTAGAAGGGCAACGAGTTTCTAATA
CTCATAATGGTGAGAATTATAAAAATATAGAGTTATTAATAGAGCCTAAATTACGTTTCGCCGATTATAG
AAAAAATTGCAGAATATTTCAGCATAAAGATATAAAAGAAATTATCTCCGAAGTACTCTCGGAGCATAGT
GTCGCCTTTAGTTTTGAGTTAACTAAGTCGTACCCTAAATACACATACAAAGTGCAATATGAAGAGTCAG
ACCTTGAATTTGTCCGACGCTTATTGTCAGAAGAAGGGCTATCGTTCTGTTTCACACACACTAAGTCTGT
CCACACGCTTAAGATTTTTGATGACATCAGTTTCTATAAGCCGGGTACAGAGTTTTTAGTCGATTTTGAT
ACAGGTACGGCTAAGTCTAGCCATATTTCTTCTTGGCATGAAACCCAAGTTTTGACGACTAAAGCAAGCC
AAAAGTCTGGCTATAACATGCTTAAGCCTTCGTCTAATCCTAAAAATACTGCCAAGGGTGAAAGTGATTT
TTTTACCGTGCCTGAAAGCGAGTATTTTGAATACATGGGTGAAACGGAAAGTGATGATCAATACGCACTT
AGAAACACGCACGCTATAGAAGCACTACAGCAAAACGCATATCTGTGTCGTGGCGAGGCAACGTGTCGAA
CGTTCAGTGTGGGAAAGTGCTTTAAGTTTAAAAAGCATGAAGATAAGTCTCGAGTCGGCAAAGAATACGT
ACTGTCCGCCGTTTTTTTATCTGCGGCTGTTTATAATCAGACTGGTCAAGGTGGCACTGCTGCGCAAGGT
GTTAAAGTATCATTTAGTTGTGTTGACTCAAAAACAATCCTTCGCCCTTCTGTGAACTATCCGAAACCTC
AGATGAAAGGTTTGCAAACCGCAGTGGTAACGGGAAACAAAGATGGCGAAATTTACATAGACAAACACGG
TCGTATTAAAGTTCAGTTTCACTGGGATCGTGTTGGTAAATACGATGTAAACAGCTCATGTTGGATTCGT
GTTGCGCAAAATATCGCGGGTAACGGATGGGGCTCGGTGTTTCATCCTAGAGTAGGACAAGAGGTCATCG
TCGAGTTTGTCAATGGCGATCCTGACCAGCCAATTGTTACGGGGTCACTGTACAATGGTAGTCAACTCCC
TCCCTACACGTTACCAGAGCAAAGCTCTCAAAGTGGTTATAAATCGCGTTCTGTACAAAAAGGCACATCT
AATTTTAATGAGTTGCGCTTTGATGACAAACCCGGTGAAGAACACATCTATCTTCATGCCGAAAAACTTT
TCCAAATGCTAGTTGAAGACTGTGTTGATATTGCCGTTGAAAACAGTAAAACCGAAAAAGTGACGAATGA
TGTCAATCAAGAGATTGGCAAGAATGCGACCTTGAAAGTAGGTAAAAACTTTTCTAATGAAACGGGTGAA
GTGTTGTCTTTTAATGCAGGAAAGAGTATCGAGATCAAAGTCGGTGGCGCTTCGATTCAGATGTCTAGTT
CCGGAGAAATCAACATCAAAGGCAATAAAATATCTATTAACGGCTCTGCTATCGCTCTTAAAGCTGGGCA
AATTTCATTGAACTAA