SecReT6
Protein ID: 262395730
SecReT6 ID371
T6SS typei1
Gene symbol-
Locus tagVEA_000430
StrainVibrio sp. Ex25
Repliconchromosome II [GenBank: NC_013457] [Browse all T6SS(s) in this replicon]
Location [Strand]488924..490249 [-]
Producthypothetical protein
NoteTssK
UniProt IDA7JYG1
KEGG IDvex:VEA_000430
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.10E-141, Aligned region: 19..440
Protein Sequence: 441 a.a.     [Download]
>gi|262395730|ref|YP_003287583.1| hypothetical protein VEA_000430 [Vibrio sp. Ex25]
MSLYNPVVWQDGMFMKPQHFQQLDRSQSKLSSMLSNNASPLHWGIKRLEINSQLLALGKIGITRAEGILQ
DRTPFELPLLAELPEVKDVDPSIADKVVYLCCPLPSERSELFGTKKDGARYTMESQEAVDACYDSEDMAN
IVVGKLNFCLMYDHEDKSAYTSIPILKISEVKPDGSVILDDSFIPTCIDIHASTVLNKFATEFASMLKHR
AESIVQRLGVVDQQGVSSVSDFMLLQALNRYEPLFWHFANTEAVHPESLYRILLQAEGELSTLCSTTRRP
IEFTKYNHGDLTSCLSRVLDSAKMTLSVMSEQRAIPLTLKDQNYGIRTAAIPDNKIIDTTTFILAVKADV
TLDVLHTQFVSQTKIGSIDNIRDLINLQLPGIEIKPMPVVPRALPYHAGYTYFELDKTGEEWMALKNTAA
IAIHVAGDFANLSLQLWAVRL
 
Nucleotide Sequence: 1326 bp     [Download]
>gi|262395299|ref|NC_013457.1|:c490249-488924 Vibrio sp. Ex25 chromosome 2, complete genome
ATGTCTTTATACAATCCAGTTGTTTGGCAAGATGGAATGTTCATGAAGCCGCAGCATTTTCAACAACTCG
ATCGTTCGCAAAGTAAACTGTCGAGTATGTTGAGCAACAACGCGTCTCCTTTACATTGGGGGATTAAGCG
TTTGGAAATTAATTCACAACTGCTAGCTCTCGGTAAAATTGGTATTACGCGTGCAGAAGGCATCCTACAG
GACCGTACGCCATTTGAGCTTCCACTGCTCGCTGAACTACCAGAAGTGAAAGATGTGGATCCTTCGATTG
CCGATAAAGTGGTTTATTTGTGCTGTCCGTTACCATCGGAACGTTCTGAGTTATTTGGCACTAAAAAAGA
CGGTGCACGTTATACGATGGAATCTCAAGAAGCGGTTGATGCTTGTTATGATTCGGAAGACATGGCAAAT
ATCGTCGTCGGTAAGCTTAACTTTTGCTTAATGTACGACCATGAAGATAAAAGTGCTTACACGTCTATTC
CGATCCTCAAGATCTCTGAAGTGAAGCCAGATGGCAGCGTGATCTTAGATGATAGTTTCATTCCTACCTG
TATTGATATTCACGCATCTACGGTACTTAATAAGTTCGCGACGGAGTTTGCTTCTATGCTCAAGCACCGC
GCAGAATCCATAGTTCAGCGACTGGGAGTGGTGGATCAACAAGGCGTATCATCAGTTTCTGACTTTATGC
TATTGCAAGCGCTCAATAGATACGAACCCTTGTTTTGGCATTTTGCAAACACAGAAGCTGTACACCCTGA
GTCTTTGTATCGAATTCTTCTTCAGGCAGAGGGCGAGCTTTCGACGCTGTGCTCGACGACACGCCGACCT
ATTGAGTTTACTAAATACAATCATGGTGATCTTACTAGCTGTCTTTCTCGCGTTCTAGACAGTGCGAAAA
TGACATTGAGCGTGATGTCTGAACAAAGAGCAATTCCACTGACCTTAAAAGATCAGAACTATGGCATCAG
AACGGCAGCGATCCCTGACAATAAGATCATTGATACGACGACCTTTATTCTTGCAGTTAAAGCCGACGTT
ACCTTGGATGTCCTGCATACGCAGTTTGTCAGCCAAACGAAGATCGGTTCAATCGATAACATTCGCGACT
TGATTAACCTTCAACTGCCAGGGATTGAGATCAAACCAATGCCAGTTGTGCCACGCGCGCTGCCGTATCA
CGCTGGCTATACCTATTTCGAGCTCGATAAAACGGGTGAAGAGTGGATGGCATTGAAGAACACTGCTGCG
ATTGCGATTCACGTTGCGGGCGATTTCGCTAACTTATCATTGCAACTTTGGGCCGTTCGTCTATGA