SecReT6
Protein ID: 262395731
SecReT6 ID371
T6SS typei1
Gene symbol-
Locus tagVEA_000431
StrainVibrio sp. Ex25
Repliconchromosome II [GenBank: NC_013457] [Browse all T6SS(s) in this replicon]
Location [Strand]490261..490761 [-]
Producttype VI secretion lipoprotein/VasD
NoteTssJ
UniProt IDA7JYG2
KEGG IDvex:VEA_000431
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.60E-34, Aligned region: 11..152
Protein Sequence: 166 a.a.     [Download]
>gi|262395731|ref|YP_003287584.1| type VI secretion lipoprotein/VasD [Vibrio sp. Ex25]
MRSIAVLLGFAMLSGCSMWDQFKESTGITPETSSIELVIEASPVLNVRDGGQSSPVILRLHELNSPVLFR
SLDFFALFENDKASLGDEYIKRYEYQIQPGGKVHEMLTLDPDTRAVGFSVAFRDIDGSSWRKVEVIEEKS
EYYIKLKLEGSELISDNTRGIEQVYF
 
Nucleotide Sequence: 501 bp     [Download]
>gi|262395299|ref|NC_013457.1|:c490761-490261 Vibrio sp. Ex25 chromosome 2, complete genome
ATGCGTAGTATCGCCGTATTACTCGGATTTGCCATGTTGTCCGGTTGTTCCATGTGGGATCAATTTAAAG
AGTCCACGGGTATCACACCAGAAACTTCGTCCATTGAATTGGTTATTGAGGCGTCACCTGTACTCAATGT
GAGAGATGGGGGGCAGTCATCTCCGGTCATTCTCCGCCTTCACGAATTAAATTCGCCAGTTTTATTCCGA
AGCTTAGATTTTTTTGCGCTGTTTGAAAACGATAAAGCGTCGTTGGGTGATGAGTACATCAAACGTTATG
AATATCAAATACAGCCAGGTGGAAAAGTTCATGAAATGCTAACGCTAGACCCTGACACTCGTGCCGTCGG
TTTTTCTGTGGCCTTTCGTGATATTGATGGTTCGTCATGGCGTAAAGTTGAAGTCATTGAAGAGAAGAGC
GAGTACTACATCAAGCTCAAGTTAGAAGGCAGTGAGTTAATTTCTGATAATACTCGCGGCATTGAACAGG
TTTACTTTTAA