SecReT6
Protein ID: 262395732
SecReT6 ID371
T6SS typei1
Gene symbol-
Locus tagVEA_000432
StrainVibrio sp. Ex25
Repliconchromosome II [GenBank: NC_013457] [Browse all T6SS(s) in this replicon]
Location [Strand]490754..492247 [-]
Producthypothetical protein
NoteFha
UniProt IDA7JYG3
KEGG IDvex:VEA_000432
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 5.80E-18, Aligned region: 31..97
Protein Sequence: 497 a.a.     [Download]
>gi|262395732|ref|YP_003287585.1| hypothetical protein VEA_000432 [Vibrio sp. Ex25]
MHSNQLVLFISKCPEEYTGAKHIEMPESGGSMGRSPSCSVSLTDHNRFISGTHCLISVYGDTYYISDVST
NGTMVNGNKILKNQPVAIVDGDIISLGQYEIGVSLEHVTSTQDIAADIAPERVSNDPLVSLGDAVVEEEE
KVGALEDLFMETKQDDIDCHDPVAHLNFSMQRDDDYLIRDDEHPEPEQPKTVESTRQVVDDSFSIYSEFD
QPSLIPEDWMATETKSNASIKGSLGGENDTPYREDIVSEETVQPQTTILDRAVQRQHRAPNSTETIVEHT
AKGSKWEEMTQSFTPSSQTNQPLQMPAVEPTINSTTKEQAGIEATACSQDIAQAFFDGLGIRNPELMTNE
AQLFKQMGTCLRLCIDNLQKELHEVESLKEEQSTSESNSNIAELMLTLNSQHLLAPNELVEQMLDELNDH
QVTFNKALNELILEQSETNDPVAFANKVASQSLFSTKSKLWGEYLDFYSNNRRLLNETSLKGLIKKNYNK
VIKGNHA
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|262395299|ref|NC_013457.1|:c492247-490754 Vibrio sp. Ex25 chromosome 2, complete genome
ATGCACTCAAATCAGCTAGTTCTATTTATTTCTAAATGCCCAGAGGAATACACGGGTGCTAAGCACATTG
AAATGCCCGAGAGTGGCGGTTCAATGGGGCGTTCACCAAGTTGTAGTGTGTCTTTAACCGATCACAACCG
CTTTATATCAGGCACTCATTGCCTAATCAGTGTGTATGGAGATACCTACTATATTAGTGACGTATCCACC
AATGGCACTATGGTTAACGGGAACAAAATACTAAAAAATCAACCTGTTGCGATAGTCGATGGCGATATTA
TTTCTTTAGGACAATATGAAATTGGCGTTTCTCTGGAGCATGTTACCTCGACACAAGACATTGCCGCTGA
TATAGCCCCTGAGCGAGTATCCAATGATCCTTTGGTTAGCCTCGGTGACGCAGTTGTCGAAGAAGAAGAA
AAAGTAGGCGCTTTAGAAGATTTGTTTATGGAGACTAAACAGGATGACATTGATTGTCATGATCCTGTTG
CGCACCTTAACTTTTCAATGCAGCGAGATGATGATTATTTAATTCGTGACGATGAGCATCCAGAACCTGA
ACAGCCTAAAACGGTGGAAAGCACACGTCAGGTGGTCGATGACAGTTTCAGCATATACTCCGAGTTCGAT
CAGCCAAGCCTCATCCCTGAAGATTGGATGGCTACGGAGACCAAGAGTAACGCATCAATAAAGGGTTCGT
TAGGGGGAGAGAACGATACGCCATATAGAGAAGATATTGTCTCAGAAGAGACGGTTCAACCCCAAACGAC
GATTCTAGATAGGGCAGTTCAAAGACAACATCGTGCACCTAACTCCACAGAGACGATCGTCGAACATACT
GCTAAAGGTTCAAAATGGGAAGAGATGACACAGTCATTTACTCCTTCTTCTCAAACTAATCAGCCACTTC
AAATGCCTGCGGTAGAACCTACGATAAACAGTACGACTAAAGAGCAAGCGGGTATCGAAGCAACCGCCTG
TTCTCAAGATATAGCACAAGCGTTTTTTGATGGTTTGGGTATAAGAAATCCTGAGCTAATGACGAATGAA
GCTCAGTTGTTCAAACAAATGGGCACTTGTTTGCGCTTATGTATTGATAACCTACAGAAAGAATTACACG
AAGTAGAGTCCTTGAAAGAAGAGCAGAGTACGAGTGAGTCTAACTCTAACATTGCAGAGCTGATGCTGAC
TCTCAATAGCCAACATCTACTGGCTCCAAATGAACTGGTAGAACAAATGCTTGATGAGTTGAATGACCAC
CAAGTCACGTTTAACAAAGCGCTGAATGAGCTCATTTTAGAACAATCAGAGACGAACGATCCCGTTGCAT
TTGCTAACAAAGTGGCGAGTCAATCTTTGTTCTCAACGAAGTCAAAACTGTGGGGCGAATATTTAGATTT
CTACTCTAACAATCGTCGCCTGCTCAACGAAACATCCTTAAAAGGGCTGATTAAGAAAAACTATAACAAA
GTGATTAAGGGAAACCATGCGTAG