SecReT6
Protein ID: 262395734
SecReT6 ID371
T6SS typei1
Gene symbol-
Locus tagVEA_000434
StrainVibrio sp. Ex25
Repliconchromosome II [GenBank: NC_013457] [Browse all T6SS(s) in this replicon]
Location [Strand]493395..494708 [+]
Producthypothetical protein
NoteTssA
UniProt IDA7JYG5
KEGG IDvex:VEA_000434
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.00E-18, Aligned region: 46..104
Protein Sequence: 437 a.a.     [Download]
>gi|262395734|ref|YP_003287587.1| hypothetical protein VEA_000434 [Vibrio sp. Ex25]
MFFSDFARRPIDENNPSGSNPNGSEDFDEIKRQINNLNKVTGRVSWKTVQTLSKKILSTHSKDLRCCCYF
TVASTYNDGLRGLVEGLNSLLDVCVVYWNTAYPEHSKSKARMSAIEWMVEHTEKRINKHRALPEELPLIE
AAHQLCLRIEEELRLHYGIQAPSFGRIRRILNQWAEQIKEQQHAIELREKKQANTNASASAQATPEIKVN
VSPSPAPDSPSPLNNNEKTTPTKSGRFMIYFIIGLIVTAICSHFVYEQQRYRTLEQKISQASLNELVKLV
ASLDYENKKYAQSLKTPTINRVDIMMNNWFLDSAKVSNVSELDSLTNELIAIYPDSSSAQQLRQNFLTQS
AHLEDQFMDVYKRFSDARTVFANVARQNVDKNSKTAYEYSNSLFPLLGRIEYAEKYSQQKEIDRATLLLN
IYLYKLSQLQAEKTDNK
 
Nucleotide Sequence: 1314 bp     [Download]
>gi|262395299|ref|NC_013457.1|:493395-494708 Vibrio sp. Ex25 chromosome 2, complete genome
ATGTTTTTTAGCGACTTCGCTCGAAGACCAATCGATGAAAATAACCCAAGCGGCTCTAACCCTAATGGCT
CTGAAGACTTTGACGAAATAAAACGTCAAATAAATAATCTTAATAAAGTCACCGGAAGAGTCTCTTGGAA
AACGGTTCAAACACTCTCAAAAAAAATCTTGAGCACTCACTCTAAAGACTTACGTTGTTGCTGCTACTTC
ACGGTCGCATCAACATATAACGATGGTCTAAGAGGCCTTGTTGAAGGGTTAAATTCATTGCTTGATGTGT
GTGTCGTCTATTGGAACACCGCATACCCTGAACATTCAAAGTCAAAAGCACGAATGAGCGCAATTGAATG
GATGGTGGAGCATACTGAAAAACGTATTAATAAGCACCGTGCGTTGCCGGAAGAACTTCCACTGATTGAA
GCTGCGCACCAGTTGTGTTTAAGAATAGAGGAAGAGCTTCGCCTTCATTACGGTATTCAAGCGCCTTCAT
TTGGTCGCATTCGTCGTATCTTAAACCAATGGGCTGAACAGATAAAAGAACAACAACATGCCATAGAGTT
ACGTGAGAAAAAACAAGCAAATACTAACGCTTCAGCTTCCGCACAGGCAACACCTGAAATTAAAGTGAAT
GTATCTCCCTCTCCTGCCCCGGACTCGCCATCCCCCCTCAATAACAATGAAAAAACGACCCCAACAAAGT
CCGGCCGATTTATGATCTACTTCATCATTGGCTTGATTGTTACGGCGATATGTTCACATTTTGTTTACGA
ACAACAACGCTATCGAACGCTGGAGCAAAAAATTAGTCAAGCTTCACTTAATGAACTTGTAAAGTTGGTC
GCCTCGTTAGATTACGAAAATAAAAAATATGCCCAGTCACTGAAAACACCAACTATTAATCGCGTAGATA
TTATGATGAATAACTGGTTTTTAGACTCGGCCAAAGTAAGTAACGTCAGCGAGCTCGATAGCTTGACCAA
TGAATTAATCGCAATCTATCCAGATTCATCTTCTGCCCAGCAGTTACGTCAAAACTTTTTGACACAGAGC
GCCCATTTAGAAGACCAGTTTATGGATGTGTATAAGCGATTTTCAGACGCAAGAACGGTGTTTGCCAACG
TAGCTAGACAGAATGTAGATAAGAACTCTAAAACGGCGTACGAATATAGTAACTCACTATTCCCGCTTCT
AGGTCGTATTGAATACGCTGAAAAGTATTCACAGCAAAAGGAAATTGACCGCGCAACCCTTTTACTGAAC
ATCTACCTATATAAATTGAGTCAGCTACAAGCTGAAAAAACTGACAATAAATAA