SecReT6
Protein ID: 262395738
SecReT6 ID371
T6SS typei1
Gene symbol-
Locus tagVEA_000438
StrainVibrio sp. Ex25
Repliconchromosome II [GenBank: NC_013457] [Browse all T6SS(s) in this replicon]
Location [Strand]499659..501407 [-]
Productprotein ImpG/VasA
NoteTssF
UniProt IDA7JYG9
KEGG IDvex:VEA_000438
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.40E-191, Aligned region: 5..582
Protein Sequence: 582 a.a.     [Download]
>gi|262395738|ref|YP_003287591.1| protein ImpG/VasA [Vibrio sp. Ex25]
MSNSKYFQDELTYLRESGSEFAKYHPKLTHFLSEGTFDPDVERLLEGFAFLTGRIREKIDDELPELTQSL
MTLLWPHYMRSIPSLCISELKPHTGSVTEKTVVKRGAEMASEQVEGTQCLFRTCYDVNLYPITITNIEQT
NSRTSSMIDVTLSTEHGLELSRIGLDTLRLHLHGEIHITRTVFLWLFRYLDYVELDVGGGYKHRLGPEYV
KPVGHEEDEALLPYSKNSFAGYRLLQEFFSLPDKFMFFDIKGLEWLKGIPQRSTVKIKFHFKRALPSEVV
LKDKHLKLHCTPAVNLFEKDGDPIRLEHRRNEYKVRPQSNTQEHYEVYSIEQVESWSKDERRRKSLIEFE
SFEHQINQRDKREFYKSKVAERVSGRGLERYISFHTHNGDIAELGTETVLMKLQCSNADLAERLSVGDIT
YATHKSPTYATFRNITKPTQSVSPQVNGELQWQLIANMSLNYLSLANIDVLKVLLSTYDFHSRVDRQAHR
ASIHRLDGVISSEMKPIDRVFRGVSVRGNQFKLVTNSKFFVNEGDMFLMATVLNEFIRLYSSVNSFTELE
VFDEATGEVYNWASLIGQQTIL
 
Nucleotide Sequence: 1749 bp     [Download]
>gi|262395299|ref|NC_013457.1|:c501407-499659 Vibrio sp. Ex25 chromosome 2, complete genome
TTGAGTAACAGTAAATACTTTCAAGATGAACTCACGTATTTGCGTGAGTCGGGTAGTGAGTTTGCCAAAT
ATCATCCGAAGTTAACTCACTTTCTCTCTGAGGGAACCTTTGACCCAGATGTCGAACGACTGCTCGAAGG
TTTTGCCTTTCTGACAGGTAGAATCCGCGAGAAGATTGATGATGAACTGCCTGAGCTGACGCAATCTCTG
ATGACTTTGCTGTGGCCACATTACATGCGTTCGATTCCGTCTTTGTGCATTAGCGAACTAAAGCCGCATA
CCGGAAGTGTTACTGAGAAAACCGTGGTGAAACGTGGCGCAGAAATGGCGAGTGAACAGGTAGAGGGCAC
GCAATGTTTGTTCCGTACTTGTTACGACGTCAATCTATACCCAATTACGATCACTAACATCGAACAGACC
AACAGCCGCACCAGTTCGATGATTGATGTGACTTTATCGACGGAGCATGGTCTTGAACTGTCTCGGATCG
GTTTAGACACGCTGCGATTACACTTGCATGGCGAGATTCATATTACTCGAACTGTCTTCTTATGGCTGTT
CCGTTACCTAGATTATGTCGAATTAGATGTTGGTGGTGGTTACAAACATCGCTTAGGGCCAGAATATGTT
AAGCCAGTTGGGCATGAAGAGGACGAAGCGCTCCTGCCTTACAGCAAAAATTCATTTGCAGGCTACCGTT
TGCTGCAAGAATTCTTCTCTTTGCCAGATAAGTTCATGTTCTTCGACATTAAAGGCTTAGAGTGGCTAAA
AGGCATTCCACAACGTAGCACGGTCAAAATCAAATTCCACTTTAAGCGTGCATTACCGTCAGAAGTGGTG
CTTAAAGATAAACACTTGAAGTTGCACTGTACGCCTGCCGTTAATTTATTTGAAAAAGATGGCGATCCAA
TTCGTTTAGAGCACCGACGTAACGAGTACAAGGTACGCCCGCAAAGCAACACTCAGGAGCATTACGAAGT
CTATTCCATTGAGCAAGTGGAAAGCTGGAGTAAAGACGAGCGTCGTCGAAAGTCTCTGATTGAATTTGAA
TCATTTGAGCATCAAATTAACCAACGAGATAAGCGCGAGTTCTACAAATCTAAAGTCGCTGAGCGTGTAA
GCGGTAGAGGCCTTGAACGCTACATATCATTTCATACTCATAATGGGGACATTGCGGAACTGGGAACAGA
AACTGTACTCATGAAACTGCAATGTAGTAACGCAGATTTGGCGGAACGTTTGTCAGTGGGGGACATCACT
TACGCGACTCATAAATCACCGACCTATGCGACGTTTAGGAATATTACCAAGCCCACTCAATCGGTCAGTC
CGCAAGTGAATGGTGAGCTTCAGTGGCAGTTAATTGCGAATATGTCACTCAACTACTTATCGCTGGCAAA
TATTGATGTACTTAAAGTGCTTCTCTCTACCTATGATTTCCACTCTCGTGTTGATAGACAAGCGCACCGC
GCATCCATTCATCGACTTGATGGGGTTATCTCTTCGGAAATGAAACCAATCGACCGTGTGTTTCGTGGCG
TTTCGGTACGCGGCAATCAGTTTAAGTTGGTCACCAATTCCAAATTTTTTGTCAATGAAGGCGACATGTT
CTTGATGGCGACGGTGCTTAACGAATTCATCCGTTTGTACTCGAGTGTGAACTCCTTTACCGAACTGGAA
GTGTTTGATGAAGCGACAGGCGAGGTTTATAACTGGGCAAGTCTTATCGGACAGCAGACGATACTATGA