SecReT6
Protein ID: 262395739
SecReT6 ID371
T6SS typei1
Gene symbol-
Locus tagVEA_000439
StrainVibrio sp. Ex25
Repliconchromosome II [GenBank: NC_013457] [Browse all T6SS(s) in this replicon]
Location [Strand]501418..501828 [-]
Producthypothetical protein
NoteTssE
UniProt IDA7JYH0
KEGG IDvex:VEA_000439
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.80E-21, Aligned region: 24..116
Protein Sequence: 136 a.a.     [Download]
>gi|262395739|ref|YP_003287592.1| hypothetical protein VEA_000439 [Vibrio sp. Ex25]
MEKGYRLLERIELGEPKNCYEKVVSHKHLIESIHSHLADLLNTHSGNAMIDNEYGLPDFNDVLSNNTNLV
RHIQKNITSTIERFEPRLLNVEVNYREDHHNPLQLGFGIRGEVSHNGGKVPMSIDVYMGTDGQFNV
 
Nucleotide Sequence: 411 bp     [Download]
>gi|262395299|ref|NC_013457.1|:c501828-501418 Vibrio sp. Ex25 chromosome 2, complete genome
ATGGAAAAAGGTTATCGCCTTTTAGAGCGGATTGAGCTTGGTGAACCCAAAAACTGTTACGAGAAAGTCG
TTTCTCACAAGCATTTGATTGAATCTATTCATTCTCATCTCGCAGACTTGCTGAATACACATTCTGGGAA
TGCAATGATCGACAATGAGTATGGTTTACCAGATTTTAATGACGTACTTTCTAACAACACGAACCTAGTT
CGCCACATTCAAAAAAACATCACGTCAACCATAGAACGCTTTGAACCGCGACTGTTGAATGTCGAGGTTA
ATTATCGTGAAGATCACCATAACCCGCTACAACTCGGCTTTGGTATTCGCGGCGAAGTTTCCCATAACGG
CGGTAAAGTCCCAATGTCGATAGACGTCTACATGGGAACCGACGGCCAATTTAACGTTTAG