SecReT6
Protein ID: 262395740
SecReT6 ID371
T6SS typei1
Gene symbol-
Locus tagVEA_000440
StrainVibrio sp. Ex25
Repliconchromosome II [GenBank: NC_013457] [Browse all T6SS(s) in this replicon]
Location [Strand]501890..503365 [-]
Producthypothetical protein
NoteTssC
UniProt IDA7JYH1
KEGG IDvex:VEA_000440
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.60E-187, Aligned region: 66..490
Protein Sequence: 491 a.a.     [Download]
>gi|262395740|ref|YP_003287593.1| hypothetical protein VEA_000440 [Vibrio sp. Ex25]
MSAEAQAPEQEAALVESGSLLDSILNETRLKPSDEGFDVAKRGVEAFISELLSSSNTEKVDQSLVDLMIS
EIDQKLSKQVDAILHNEEVQAIESTWRGLKYLVDHTDFRENIQIELISAKKDEVLDDFEDAPEVVKSGLY
KQIYTREYGQFGGKPVGAVICDYDMSASSPDIKLMEYMANVGAMSHAPFITSASAKFFGLDSYEELPNLK
DLKSVFEGPQYTKWRSLREHEDARYLGLCTSRFMLRTPYSVEDNPIKAFDYDEQVTDSHDNYLWGNSAYA
MASKISESFAKYRWCPNIIGPQSGGTVHDLPVYNFEAMGQIETKIPTEILVSDRREYELAEEGFIALTMR
KGSDNAAFFSANSVQKPKVFANTPEGKQAEMNYKLGTQLPYMFIINRLAHYIKVLQREQIGSWKERSDLE
IELNKWIRQYVSDQENPPAEVRGRRPLRAAKVEVSDVEGDPGWYKVSMSVRPHFKYMGASFDLSLVGKLD
Q
 
Nucleotide Sequence: 1476 bp     [Download]
>gi|262395299|ref|NC_013457.1|:c503365-501890 Vibrio sp. Ex25 chromosome 2, complete genome
ATGTCTGCAGAAGCACAAGCGCCAGAACAAGAAGCAGCCTTAGTTGAATCAGGCTCACTTCTGGATAGCA
TTCTTAACGAAACTCGTTTAAAGCCAAGTGATGAAGGTTTTGATGTTGCAAAACGCGGCGTAGAAGCATT
CATCAGTGAGCTACTAAGCAGCTCGAACACAGAGAAAGTGGATCAGTCTTTAGTTGATCTGATGATCTCA
GAAATTGACCAAAAACTGTCTAAGCAAGTTGATGCAATTCTTCACAACGAAGAAGTTCAAGCGATTGAAT
CAACTTGGCGTGGCCTTAAGTACCTGGTTGACCACACTGACTTCCGTGAGAACATTCAAATTGAATTGAT
CTCTGCAAAGAAAGATGAAGTTCTTGATGACTTCGAAGACGCGCCAGAAGTGGTGAAGTCTGGTTTGTAC
AAACAAATCTATACGCGTGAATATGGCCAATTTGGTGGTAAACCTGTTGGCGCAGTCATTTGTGACTACG
ATATGTCGGCTTCGTCTCCAGACATCAAACTGATGGAGTACATGGCAAACGTGGGTGCAATGTCTCATGC
TCCATTTATTACATCTGCGTCTGCGAAGTTCTTTGGTTTAGATAGCTATGAAGAGCTACCGAATCTAAAA
GATCTTAAGTCAGTATTTGAAGGCCCACAATACACTAAATGGCGTAGTCTACGTGAACACGAAGATGCAC
GTTACCTAGGTCTATGTACGTCTCGCTTTATGCTACGTACACCTTACTCTGTAGAAGATAACCCAATTAA
GGCGTTTGACTACGATGAGCAAGTAACAGACAGCCATGACAACTACCTATGGGGTAACTCTGCGTACGCG
ATGGCATCAAAAATTAGTGAGTCTTTCGCTAAGTACCGTTGGTGTCCAAACATCATTGGTCCTCAAAGCG
GTGGTACTGTGCATGACTTACCGGTTTACAACTTTGAAGCCATGGGTCAAATCGAAACTAAGATCCCAAC
TGAGATTCTTGTTTCTGACCGTCGCGAGTACGAGCTAGCAGAAGAAGGCTTCATTGCGCTAACCATGCGT
AAAGGTTCTGACAACGCGGCGTTCTTCTCTGCAAACTCTGTTCAAAAACCGAAAGTGTTTGCGAACACGC
CAGAAGGCAAACAAGCAGAGATGAACTACAAGCTAGGTACTCAGCTTCCTTACATGTTCATCATCAACCG
TCTAGCACACTACATAAAAGTGCTACAGCGTGAGCAAATCGGTTCGTGGAAAGAGCGTTCAGACCTAGAA
ATTGAACTGAACAAGTGGATTCGTCAATACGTTTCTGACCAGGAAAACCCGCCAGCAGAAGTCCGTGGTC
GTCGTCCACTACGTGCTGCTAAGGTTGAAGTATCAGACGTAGAAGGTGACCCAGGTTGGTACAAAGTATC
AATGTCTGTACGTCCTCACTTCAAGTACATGGGTGCAAGCTTCGACTTGTCTCTAGTTGGTAAGTTAGAC
CAATAA