SecReT6
Protein ID: 262395741
SecReT6 ID371
T6SS typei1
Gene symbol-
Locus tagVEA_000441
StrainVibrio sp. Ex25
Repliconchromosome II [GenBank: NC_013457] [Browse all T6SS(s) in this replicon]
Location [Strand]503374..503880 [-]
Producthypothetical protein
NoteTssB
UniProt IDA7JYH2
KEGG IDvex:VEA_000441
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.00E-59, Aligned region: 5..158
Protein Sequence: 168 a.a.     [Download]
>gi|262395741|ref|YP_003287594.1| hypothetical protein VEA_000441 [Vibrio sp. Ex25]
MSRDGSVAPKERINIRYVPATGDTQEDVELPLSMMVVGDFTARADETPIEERTPINIDKDNFNEVLEGMS
PNVKVNVENRLSDEEGGQIGVDLTFQNMKDFSPEAIAKSVPELNSLLELREALVALKGPLGNVPAFRKKI
ASVLQDEDARKKLLDELSIGNDQEAKEE
 
Nucleotide Sequence: 507 bp     [Download]
>gi|262395299|ref|NC_013457.1|:c503880-503374 Vibrio sp. Ex25 chromosome 2, complete genome
ATGTCACGTGACGGCTCGGTGGCTCCTAAAGAGCGAATTAATATCCGTTATGTTCCAGCAACTGGCGATA
CGCAAGAAGACGTAGAACTGCCGCTAAGCATGATGGTGGTTGGCGACTTTACTGCACGTGCAGATGAGAC
GCCAATTGAAGAACGCACTCCAATCAATATCGATAAAGACAACTTTAACGAAGTGCTAGAAGGCATGTCT
CCAAACGTTAAAGTGAACGTTGAAAACCGTCTTTCTGATGAAGAAGGCGGCCAAATCGGTGTTGATCTAA
CGTTCCAAAACATGAAGGACTTCTCTCCAGAAGCGATTGCGAAAAGCGTGCCTGAACTAAACAGCCTGCT
TGAACTTCGCGAAGCCTTGGTGGCGCTGAAAGGCCCTCTAGGTAATGTTCCTGCATTCCGCAAGAAGATC
GCATCGGTTCTTCAAGATGAAGACGCGAGAAAGAAACTGTTGGATGAACTAAGCATTGGTAACGACCAAG
AAGCAAAAGAAGAGTAA