SecReT6
Protein ID: 262395742
SecReT6 ID371
T6SS typei1
Gene symbol-
Locus tagVEA_000442
StrainVibrio sp. Ex25
Repliconchromosome II [GenBank: NC_013457] [Browse all T6SS(s) in this replicon]
Location [Strand]503907..505475 [-]
Producthypothetical protein
NoteTssA
UniProt IDA7JYH3
KEGG IDvex:VEA_000442
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.90E-18, Aligned region: 48..108
ImpA-rel_N [PF06812], Evalue: 2.90E-18, Aligned region: 496..509
Protein Sequence: 522 a.a.     [Download]
>gi|262395742|ref|YP_003287595.1| hypothetical protein VEA_000442 [Vibrio sp. Ex25]
MSNIDTDHLLKPISDESPAGNDARYEFCYEMMEAEVKKFGSLFGETVDWNVVKTNAMEVLEHHSKDLKAL
CYLVRALAEESGLKGFEQGLKLLNEALACFGSDLYPSRKRGRDGAVEWLNHQFKLMSTKLADSAQSWELV
SGCISTIEEVQRQYDDVYQDSEADFFEIRTQLNVLSQQAAADDQSDDAIATIEQAAPATQPAAVETPAQN
DVQTASAKTVPPTPKPAPVKKAVAKEVDVDTDFSSPTASKRTLKKVAEVMLHANPSDPLAYRIYRHLTWD
DIDGLPDHQNDQTPLSLAVSSDQQAEYRDKANQESDIDTIKRLERTLTDAPFWLTGHHFVYLMLTNLGFD
DAALAVKQEVKRFVESLEGIERLSFKNSIPFADEATLSWLSTQDATSSAAQTVVQTVVIAEEDSLLVEDI
TLENLGEYAAELARKLELDGSGRGQFMLYLQLIAAYQSVGLYPLCLPYLEKGWEVQNAFNLASWEPHLSS
QLEDLIRKTLHQLFRSKDLLPEKYEEWKAIYD
 
Nucleotide Sequence: 1569 bp     [Download]
>gi|262395299|ref|NC_013457.1|:c505475-503907 Vibrio sp. Ex25 chromosome 2, complete genome
TTGTCCAACATTGATACTGATCACCTTCTTAAACCGATTTCTGATGAATCTCCTGCGGGTAACGATGCTC
GTTACGAGTTTTGCTATGAAATGATGGAAGCCGAGGTAAAAAAGTTCGGCTCACTATTTGGCGAAACGGT
CGACTGGAATGTAGTAAAAACCAATGCGATGGAAGTGCTCGAGCATCATAGTAAAGATTTAAAAGCACTT
TGCTATTTAGTACGAGCGCTTGCAGAGGAATCCGGGCTCAAAGGTTTTGAACAAGGTCTGAAACTGCTTA
ATGAGGCGTTAGCTTGCTTCGGTAGTGATCTTTACCCGTCACGGAAACGCGGTAGAGACGGTGCGGTGGA
GTGGTTGAATCATCAATTTAAATTGATGAGCACTAAACTTGCGGACAGTGCGCAATCTTGGGAATTAGTT
TCAGGTTGCATTTCGACTATTGAAGAAGTGCAGCGTCAGTACGACGATGTTTACCAAGATTCCGAAGCTG
ACTTCTTTGAGATTCGCACGCAGCTCAATGTTTTATCTCAACAAGCAGCTGCCGATGACCAGAGCGATGA
CGCAATAGCTACCATCGAACAAGCGGCACCAGCTACGCAGCCTGCCGCGGTAGAAACGCCAGCACAGAAC
GACGTTCAAACCGCTTCAGCGAAGACGGTTCCGCCGACGCCTAAACCTGCGCCAGTTAAGAAAGCCGTAG
CAAAAGAAGTCGATGTCGATACAGATTTCTCGTCGCCTACGGCTTCAAAACGCACGTTAAAAAAAGTCGC
GGAAGTCATGCTTCATGCGAATCCAAGTGATCCGCTGGCTTACCGAATTTATCGTCATCTGACTTGGGAT
GACATTGATGGTCTACCTGACCACCAAAACGATCAAACGCCATTGAGCTTGGCGGTATCGTCCGATCAGC
AAGCGGAATACCGCGACAAAGCCAATCAGGAAAGTGACATCGACACGATTAAACGTTTGGAGCGCACGCT
AACTGACGCGCCATTTTGGCTCACAGGCCACCATTTCGTGTATTTGATGCTTACTAACTTAGGTTTTGAT
GACGCAGCACTTGCCGTGAAACAAGAAGTAAAGCGGTTTGTTGAGTCATTGGAGGGCATCGAACGCCTCT
CTTTTAAGAATTCTATACCATTTGCAGATGAAGCAACATTGAGTTGGTTGTCTACTCAAGATGCTACTTC
ATCGGCAGCACAAACTGTTGTACAGACGGTTGTGATCGCTGAAGAAGATTCATTGCTGGTGGAGGATATC
ACTCTAGAAAATCTAGGGGAATATGCCGCAGAACTTGCCCGCAAGCTTGAGCTGGATGGCTCAGGGCGTG
GACAGTTCATGCTGTATTTACAATTGATAGCAGCTTACCAGTCTGTTGGATTATACCCGTTGTGTTTGCC
GTATCTTGAGAAGGGGTGGGAAGTACAAAATGCGTTTAATCTCGCGAGCTGGGAACCCCACTTATCGTCG
CAGTTAGAAGACCTGATTCGAAAAACACTCCATCAGTTATTCAGAAGTAAGGATCTTTTACCTGAGAAGT
ATGAAGAGTGGAAAGCAATTTATGACTAA