SecReT6
Protein ID: 262395748
SecReT6 ID371
T6SS typei1
Gene symbol-
Locus tagVEA_000448
StrainVibrio sp. Ex25
Repliconchromosome II [GenBank: NC_013457] [Browse all T6SS(s) in this replicon]
Location [Strand]511526..513604 [-]
ProductVgrG protein
NoteTssI
UniProt IDA7JYH9
KEGG IDvex:VEA_000448
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.70E-70, Aligned region: 26..332
Phage_GPD [PF05954], Evalue: 6.70E-70, Aligned region: 501..537
Phage_base_V [PF04717], Evalue: 5.20E-23, Aligned region: 371..463
Gp5_C [PF06715], Evalue: 2.10E-05, Aligned region: 505..522
Gp5_C [PF06715], Evalue: 2.10E-05, Aligned region: 534..542
Gp5_C [PF06715], Evalue: 2.10E-05, Aligned region: 547..565
Gp5_C [PF06715], Evalue: 2.10E-05, Aligned region: 569..591
Gp5_C [PF06715], Evalue: 2.10E-05, Aligned region: 593..615
Gp5_C [PF06715], Evalue: 2.10E-05, Aligned region: 616..636
DUF2345 [PF10106], Evalue: 0.0092, Aligned region: 493..505
DUF2345 [PF10106], Evalue: 0.0092, Aligned region: 631..689
Protein Sequence: 692 a.a.     [Download]
>gi|262395748|ref|YP_003287601.1| VgrG protein [Vibrio sp. Ex25]
MVNDVEFKFEVPGCGHEFRVESFHVHEELSKPFHINLSLLSLDPDISFDELIRKAGTLTLYGQGVGAARV
FNGVVNEVRYLGTGRRFSRYQLVLVPQAWFLSQRQDCRIFQQKSAQDIITEVLDDGAVTDYRFEVSGTYP
PKEYVLQYRESDLHFVQRMMAEHGMWYYFDHSDSNHTMVIVDSNDAIAPLISSPLNASYIGPIVYHADGG
GVADREHISDLGLVNRVRTGQVTYTDYNYEHPKIPQEMTQAGDLDQDLKQFDYPGRYVDPLMGQVRTTEW
MSEHIVDNQQVEATSDVMRLASGYSFNVSDHPRSEINRDYLMLSVMHTGQDPQVHEDEASGMPTTYYNQF
SCIPRDVVFKAPKLAAPVVDGPQTAVVVGPEGEEIYTDKLGRVKVQFHWDRYGDNNEHSSCWIRVSQSMA
APTWGAVYLPRIGHEVVVTFLEGDPDRPLVTGAVYNGLHFPPYSLPENKTRTTFRTQTHKGTGYNELSFE
DEANQEEVYIHAQKDMSTKVLNNRYRDIGQDEFLKVARHQTNEVHGDHKETIHGHKTTQVNSTFTETVEQ
DVTVTYNANEAQYVKNNSDLEIGDNRTTKIGKNDDLDIGENSNLTIGASKSSDIGADDNQTVGGNLTVSV
KGNTAYKADGATQIISGDKIVLKTGGSSLVMNSDGSIKLSGSAITIEGSDKVVVKGGNVVVN
 
Nucleotide Sequence: 2079 bp     [Download]
>gi|262395299|ref|NC_013457.1|:c513604-511526 Vibrio sp. Ex25 chromosome 2, complete genome
ATGGTGAATGACGTAGAATTTAAATTTGAAGTGCCTGGATGTGGGCATGAATTTCGGGTTGAGAGCTTTC
ATGTTCATGAAGAGTTATCTAAGCCTTTCCACATCAATCTCTCATTACTTTCACTTGATCCAGATATCTC
GTTCGATGAGTTAATACGTAAAGCAGGAACATTGACACTTTACGGACAAGGTGTTGGGGCTGCGCGTGTG
TTCAACGGCGTGGTGAATGAAGTTCGTTACTTAGGGACTGGACGTCGTTTTTCTCGTTATCAATTAGTCT
TGGTTCCTCAAGCTTGGTTCTTATCTCAGCGCCAAGATTGTCGTATTTTCCAGCAAAAGTCAGCGCAAGA
CATCATCACAGAAGTACTCGATGATGGGGCAGTCACCGATTACCGATTTGAAGTGTCGGGTACTTATCCT
CCAAAAGAATACGTTCTGCAATACCGTGAGTCTGACTTGCACTTCGTGCAGCGTATGATGGCTGAACACG
GTATGTGGTATTACTTTGACCATAGCGATTCAAATCATACGATGGTCATTGTCGACAGTAATGACGCGAT
TGCACCTTTGATAAGCTCGCCACTAAATGCTTCTTACATTGGGCCGATTGTTTATCATGCCGATGGTGGC
GGTGTTGCCGATCGCGAACATATCTCTGATCTCGGGTTAGTTAACCGCGTTAGAACGGGACAGGTTACGT
ACACAGATTACAACTACGAACACCCTAAAATTCCACAAGAGATGACACAGGCTGGCGATCTAGACCAAGA
TCTCAAGCAGTTTGATTATCCTGGACGATACGTCGATCCGCTGATGGGTCAGGTGAGAACCACGGAGTGG
ATGTCGGAACACATAGTCGATAATCAACAAGTGGAAGCAACGAGTGACGTAATGCGCTTAGCATCTGGTT
ACAGCTTTAACGTCAGTGACCACCCGCGTTCTGAGATTAACCGCGATTACCTCATGTTGTCTGTAATGCA
CACAGGTCAAGATCCGCAAGTGCATGAAGATGAAGCGAGTGGTATGCCAACCACTTACTACAACCAGTTC
TCGTGTATTCCACGTGATGTGGTGTTTAAAGCACCTAAACTAGCGGCACCAGTAGTGGATGGCCCGCAAA
CAGCGGTTGTTGTAGGACCAGAAGGTGAAGAGATTTACACCGACAAACTTGGTCGAGTGAAAGTACAGTT
CCATTGGGATCGCTACGGTGATAACAACGAGCACTCAAGTTGCTGGATCCGCGTAAGCCAATCAATGGCG
GCGCCAACTTGGGGCGCAGTGTACTTGCCGCGTATTGGCCATGAAGTCGTAGTGACTTTCCTTGAGGGGG
ATCCAGATCGTCCGTTAGTTACGGGCGCAGTTTACAACGGTTTACATTTTCCTCCGTACTCTTTACCTGA
AAACAAAACTCGCACCACGTTCCGCACGCAAACGCACAAAGGAACAGGTTACAACGAGTTGAGTTTTGAA
GACGAAGCGAACCAAGAAGAAGTCTATATTCACGCTCAAAAAGACATGTCGACCAAGGTGCTCAACAACC
GTTACCGTGATATCGGTCAAGATGAATTCTTGAAGGTTGCACGTCACCAAACGAATGAAGTTCATGGTGA
CCATAAAGAAACCATTCATGGGCATAAAACGACACAAGTAAACAGTACGTTTACCGAGACAGTCGAGCAA
GACGTTACCGTCACATACAACGCGAATGAAGCTCAGTATGTGAAAAACAATTCTGACTTAGAAATTGGTG
ATAACCGTACGACTAAGATCGGCAAAAATGATGACTTAGATATTGGTGAAAACAGTAACCTTACTATCGG
TGCGTCTAAGAGTTCAGACATTGGTGCTGATGATAACCAGACGGTTGGTGGCAACTTAACGGTATCAGTG
AAAGGGAACACCGCTTATAAAGCCGATGGTGCGACGCAAATCATCAGTGGCGACAAGATTGTATTGAAAA
CGGGTGGTTCCTCTTTAGTGATGAACAGTGATGGTTCAATAAAGTTATCAGGCTCGGCTATTACGATCGA
AGGCAGTGACAAAGTCGTCGTGAAAGGTGGCAACGTAGTGGTTAACTAA