SecReT6
Protein ID: 262395749
SecReT6 ID371
T6SS typei1
Gene symbol-
Locus tagVEA_000449
StrainVibrio sp. Ex25
Repliconchromosome II [GenBank: NC_013457] [Browse all T6SS(s) in this replicon]
Location [Strand]513677..514195 [-]
ProductHcp protein
NoteTssD
UniProt IDA7JYI0
KEGG IDvex:VEA_000449
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.50E-36, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|262395749|ref|YP_003287602.1| Hcp protein [Vibrio sp. Ex25]
MPTPAYMSIQGETQGHITKDTYSADSVGNTWQEAHVDEFLVQELDHVLTVPRDPQSGQPTGQRVHRPLVV
TKVQDRSSPLLFNALVSGEKLPECVIRFYRTSVQGKQEHYYSIKLIDALLVDIQTRMNHCQDAATADRVT
EEVLKFTYRAIEVTHENCGTAGNDDWRAPREA
 
Nucleotide Sequence: 519 bp     [Download]
>gi|262395299|ref|NC_013457.1|:c514195-513677 Vibrio sp. Ex25 chromosome 2, complete genome
ATGCCAACTCCAGCATATATGTCTATCCAAGGTGAGACTCAAGGCCATATTACTAAAGATACTTACTCTG
CAGATTCAGTAGGTAACACATGGCAAGAAGCTCACGTTGATGAGTTCCTAGTACAAGAACTTGATCACGT
GCTAACAGTTCCACGTGATCCACAAAGTGGTCAGCCAACTGGTCAACGTGTACACCGTCCACTTGTTGTA
ACTAAAGTTCAAGATCGCTCATCTCCACTACTATTCAACGCACTAGTATCTGGCGAAAAACTTCCTGAGT
GTGTGATCCGCTTCTACCGCACTTCAGTTCAAGGTAAACAAGAGCACTACTACTCAATCAAATTGATTGA
TGCGCTACTTGTCGATATCCAAACTCGTATGAACCACTGTCAAGACGCAGCAACAGCTGACCGCGTGACA
GAAGAAGTGCTTAAGTTCACTTACCGTGCGATCGAAGTAACTCACGAAAACTGCGGTACTGCGGGTAACG
ACGACTGGCGTGCTCCACGCGAAGCTTAA