SecReT6
Protein ID: 262395750
SecReT6 ID371
T6SS typei1
Gene symbol-
Locus tagVEA_000450
StrainVibrio sp. Ex25
Repliconchromosome II [GenBank: NC_013457] [Browse all T6SS(s) in this replicon]
Location [Strand]515267..517330 [+]
ProductClpB protein
NoteTssH
UniProt IDD0M971
KEGG IDvex:VEA_000450
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 8.30E-45, Aligned region: 14..69
AAA_2 [PF07724], Evalue: 8.30E-45, Aligned region: 266..285
AAA_2 [PF07724], Evalue: 8.30E-45, Aligned region: 421..585
AAA [PF00004], Evalue: 2.00E-22, Aligned region: 15..143
AAA [PF00004], Evalue: 2.00E-22, Aligned region: 426..551
ClpB_D2-small [PF10431], Evalue: 6.40E-15, Aligned region: 592..667
AAA_5 [PF07728], Evalue: 4.90E-14, Aligned region: 15..33
AAA_5 [PF07728], Evalue: 4.90E-14, Aligned region: 87..143
AAA_5 [PF07728], Evalue: 4.90E-14, Aligned region: 425..583
AAA_16 [PF13191], Evalue: 6.90E-11, Aligned region: 14..30
AAA_16 [PF13191], Evalue: 6.90E-11, Aligned region: 57..91
AAA_16 [PF13191], Evalue: 6.90E-11, Aligned region: 199..298
AAA_16 [PF13191], Evalue: 6.90E-11, Aligned region: 397..448
AAA_16 [PF13191], Evalue: 6.90E-11, Aligned region: 490..519
AAA_16 [PF13191], Evalue: 6.90E-11, Aligned region: 647..663
AAA_22 [PF13401], Evalue: 4.30E-10, Aligned region: 13..109
AAA_22 [PF13401], Evalue: 4.30E-10, Aligned region: 423..539
Sigma54_activat [PF00158], Evalue: 2.50E-06, Aligned region: 16..78
Sigma54_activat [PF00158], Evalue: 2.50E-06, Aligned region: 228..254
Sigma54_activat [PF00158], Evalue: 2.50E-06, Aligned region: 425..546
AAA_25 [PF13481], Evalue: 5.60E-06, Aligned region: 14..38
AAA_25 [PF13481], Evalue: 5.60E-06, Aligned region: 67..108
AAA_25 [PF13481], Evalue: 5.60E-06, Aligned region: 421..457
AAA_17 [PF13207], Evalue: 1.10E-05, Aligned region: 15..78
AAA_17 [PF13207], Evalue: 1.10E-05, Aligned region: 424..448
NACHT [PF05729], Evalue: 2.40E-05, Aligned region: 15..40
NACHT [PF05729], Evalue: 2.40E-05, Aligned region: 72..113
NACHT [PF05729], Evalue: 2.40E-05, Aligned region: 213..244
NACHT [PF05729], Evalue: 2.40E-05, Aligned region: 425..450
Zeta_toxin [PF06414], Evalue: 8.60E-05, Aligned region: 13..31
Zeta_toxin [PF06414], Evalue: 8.60E-05, Aligned region: 93..135
Zeta_toxin [PF06414], Evalue: 8.60E-05, Aligned region: 424..465
IstB_IS21 [PF01695], Evalue: 0.00015, Aligned region: 8..35
IstB_IS21 [PF01695], Evalue: 0.00015, Aligned region: 425..445
IstB_IS21 [PF01695], Evalue: 0.00015, Aligned region: 535..555
AAA_19 [PF13245], Evalue: 0.00021, Aligned region: 10..34
AAA_19 [PF13245], Evalue: 0.00021, Aligned region: 422..447
AAA_18 [PF13238], Evalue: 0.00064, Aligned region: 16..35
AAA_18 [PF13238], Evalue: 0.00064, Aligned region: 290..340
AAA_18 [PF13238], Evalue: 0.00064, Aligned region: 426..454
RuvB_N [PF05496], Evalue: 0.001, Aligned region: 14..30
RuvB_N [PF05496], Evalue: 0.001, Aligned region: 68..93
RuvB_N [PF05496], Evalue: 0.001, Aligned region: 377..447
RuvB_N [PF05496], Evalue: 0.001, Aligned region: 494..518
RNA_helicase [PF00910], Evalue: 0.001, Aligned region: 15..34
RNA_helicase [PF00910], Evalue: 0.001, Aligned region: 426..447
RNA_helicase [PF00910], Evalue: 0.001, Aligned region: 527..544
AAA_14 [PF13173], Evalue: 0.0027, Aligned region: 65..129
AAA_14 [PF13173], Evalue: 0.0027, Aligned region: 424..507
AAA_33 [PF13671], Evalue: 0.0037, Aligned region: 14..30
AAA_33 [PF13671], Evalue: 0.0037, Aligned region: 211..235
AAA_33 [PF13671], Evalue: 0.0037, Aligned region: 424..445
MobB [PF03205], Evalue: 0.0061, Aligned region: 15..35
MobB [PF03205], Evalue: 0.0061, Aligned region: 234..282
MobB [PF03205], Evalue: 0.0061, Aligned region: 424..447
AAA_10 [PF12846], Evalue: 0.0073, Aligned region: 13..27
AAA_10 [PF12846], Evalue: 0.0073, Aligned region: 80..96
AAA_10 [PF12846], Evalue: 0.0073, Aligned region: 184..245
AAA_10 [PF12846], Evalue: 0.0073, Aligned region: 424..463
Protein Sequence: 687 a.a.     [Download]
>gi|262395750|ref|YP_003287603.1| ClpB protein [Vibrio sp. Ex25]
MDILARRRKNNPIAVGEPGVGKTAVVEGLALKIVQGDVPDNLKGVELYGLDMGLLQAGASVKGEFEKRLN
AVLDEVKNSPTPIILFIDEAHTLVGGGNQAGGSDAANLLKPALARGEVKTIAATTWSEYKKYFEKDPALA
RRFQLVKLDEPSPEQAALIIRGLRPAYEKSHNVYVRDDAITAAAALSARYISGRQLPDKAIDVLDTACAR
VNISLNAIPASVETLQQELAAQQRELEALERDALQQTGDKHSLANIPDLELAMETTKEELAEQEAQWHKE
KEQIQEMIALRSRLHELVFGETNEEELVAEEDSEQEQDVSPYAEMDEEAVRIAISACQEQLDAIRNGNPL
VHFEVGPDEVSHVISDWTGIPMGKMLQDEAETTLKLKESLTQSIKGQEYAIDALSEGIQTAKAGLGNPDA
PTGVFLLVGPSGVGKTETARSIADQMFGGERFMTTINMSEFQEKHTVSRLIGSPPGYVGYGEGGMLTEAV
RQRPYSVVLLDEVEKADPEVLNLFYQVFDKGTLNDGEGRTIDFKNTLIIMTSNLATHEIESLVHQSKDID
ANIIAEAIRPTLNQHFKPALLARMSVLPFVPLSDEAMTEIIHHKLNKVSQRLQSHHKLSLSYEESLVEFV
LGNCRLAETGARNIDAVINRQLLPQLSTQLLVHDKDDSHTQIEVSVDEQGTLTYAFS
 
Nucleotide Sequence: 2064 bp     [Download]
>gi|262395299|ref|NC_013457.1|:515267-517330 Vibrio sp. Ex25 chromosome 2, complete genome
GTGGACATTCTTGCTCGTCGCCGTAAAAACAACCCTATTGCTGTTGGTGAACCGGGCGTTGGTAAAACCG
CAGTAGTAGAAGGTTTGGCACTTAAGATTGTACAAGGTGACGTACCAGACAACCTCAAAGGTGTTGAGCT
TTACGGGCTAGATATGGGTCTTCTGCAAGCTGGTGCAAGCGTAAAAGGTGAATTCGAAAAACGCCTAAAC
GCGGTATTGGATGAAGTGAAAAACTCGCCAACCCCTATCATTCTTTTCATCGATGAAGCACACACCCTTG
TTGGCGGTGGTAACCAAGCGGGCGGCAGCGACGCGGCAAACTTGCTAAAACCAGCCCTAGCGCGTGGTGA
AGTGAAAACCATCGCTGCGACAACATGGTCGGAATACAAGAAGTACTTCGAGAAAGATCCTGCCCTTGCA
CGTCGTTTCCAATTGGTGAAACTCGACGAACCATCTCCTGAACAAGCAGCATTGATCATTCGTGGTCTGC
GCCCAGCATACGAGAAGTCACACAACGTTTACGTGCGTGATGACGCCATCACTGCTGCGGCAGCGCTTTC
TGCTCGTTACATCTCTGGCCGTCAACTGCCAGACAAAGCGATCGATGTACTAGATACGGCGTGTGCACGA
GTGAACATCAGCCTTAATGCCATTCCTGCTTCTGTAGAGACACTGCAACAAGAACTTGCAGCTCAACAGC
GCGAGCTTGAAGCACTTGAGCGTGATGCTCTGCAGCAAACTGGCGACAAGCACAGCCTTGCTAACATTCC
AGACCTAGAACTGGCAATGGAAACAACGAAAGAAGAGCTAGCAGAACAAGAAGCGCAATGGCACAAAGAA
AAAGAGCAGATCCAAGAGATGATTGCTCTACGCTCTCGCTTGCATGAGCTGGTGTTTGGCGAAACAAATG
AAGAAGAGCTTGTTGCAGAAGAAGATTCAGAACAAGAGCAAGACGTTTCTCCATATGCAGAGATGGATGA
AGAAGCCGTTCGCATTGCAATTTCGGCCTGCCAGGAACAGCTAGACGCAATCCGCAATGGCAACCCATTG
GTTCACTTTGAAGTTGGTCCAGATGAAGTTAGCCACGTGATCTCGGACTGGACTGGTATTCCAATGGGTA
AGATGCTTCAAGACGAAGCAGAAACCACGCTAAAACTGAAAGAAAGCCTAACACAGAGCATCAAAGGCCA
AGAATACGCTATCGATGCACTGTCTGAAGGCATTCAAACCGCAAAAGCAGGCCTAGGCAACCCAGACGCA
CCGACGGGCGTATTCCTACTGGTTGGCCCAAGTGGTGTGGGTAAAACCGAAACGGCTCGTTCGATCGCTG
ATCAAATGTTTGGTGGTGAGCGCTTTATGACGACCATCAACATGTCTGAGTTCCAAGAGAAGCACACGGT
ATCTCGCCTAATTGGTTCACCTCCGGGTTACGTAGGTTACGGTGAAGGCGGCATGCTGACAGAAGCGGTA
CGTCAGCGTCCATACTCTGTTGTACTTCTTGATGAAGTAGAAAAAGCCGACCCAGAAGTGTTGAACCTAT
TCTACCAAGTGTTCGACAAAGGTACGCTGAACGACGGCGAAGGCCGAACCATCGATTTCAAGAACACGCT
GATCATCATGACCAGTAACCTTGCGACGCACGAGATTGAATCTTTGGTTCATCAATCCAAAGACATTGAT
GCAAACATCATCGCAGAAGCTATCCGCCCTACTTTGAACCAACACTTCAAACCGGCGCTGTTGGCACGTA
TGTCGGTACTGCCATTTGTTCCGCTTTCTGATGAAGCGATGACAGAAATCATTCACCATAAGCTGAACAA
AGTTTCTCAGCGTCTACAGAGCCATCACAAGTTGTCTCTGAGCTACGAAGAAAGCTTGGTTGAGTTCGTA
CTAGGCAACTGTCGCCTTGCTGAAACGGGCGCGCGTAACATTGACGCGGTAATCAACCGTCAGTTACTGC
CTCAGCTATCGACTCAACTATTAGTGCATGACAAGGATGATTCACATACGCAAATCGAAGTGTCTGTCGA
TGAGCAAGGAACACTAACCTATGCGTTCAGCTAA