SecReT6
Protein ID: 26249220
SecReT6 ID37
T6SS typei2
Gene symbol-
Locus tagc3385
StrainEscherichia coli CFT073
Repliconchromosome [GenBank: NC_004431] [Browse all T6SS(s) in this replicon]
Location [Strand]3223002..3223523 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ8FEE0
KEGG IDecc:c3385
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.30E-52, Aligned region: 13..165
Protein Sequence: 173 a.a.     [Download]
>gi|26249220|ref|NP_755260.1| hypothetical protein c3385 [Escherichia coli CFT073]
MDDEEKDMADSFQNEVPAARVNIKLDLHTGNAKKKVELPLKLLAVGDYSNGKEQRPLSERDKVDINKNNF
NSVMAEFSPAVNLTVEDTLNGNGNEQNIALEFKSLKDFEPEQVAKNIPQLRVLLAMRNLLRDLKSNLLDN
ATFRRELENILKDPTLSSELRDELAKIAPQENV
 
Nucleotide Sequence: 522 bp     [Download]
>gi|26245917|ref|NC_004431.1|:3223002-3223523 Escherichia coli CFT073 chromosome, complete genome
GTGGATGATGAGGAAAAGGATATGGCCGACAGTTTCCAGAATGAAGTTCCCGCCGCTCGTGTAAATATCA
AGCTTGATCTGCATACAGGCAATGCTAAAAAGAAAGTTGAACTCCCCCTCAAGCTTCTTGCCGTAGGCGA
TTACAGTAACGGAAAAGAGCAACGTCCGCTGTCCGAACGGGACAAGGTTGATATCAATAAAAACAACTTC
AACAGCGTCATGGCTGAGTTTTCGCCTGCGGTTAATTTAACAGTAGAAGATACGCTAAACGGAAACGGTA
ATGAACAAAATATCGCGCTTGAATTTAAAAGCCTGAAGGATTTTGAACCCGAACAGGTAGCAAAAAATAT
TCCGCAACTTCGTGTATTACTCGCTATGCGCAATTTACTACGTGACCTGAAATCCAATCTGCTGGATAAC
GCAACGTTTCGCCGTGAACTGGAAAATATCCTGAAAGACCCGACGCTCAGTTCAGAACTGCGTGATGAAC
TGGCGAAAATTGCGCCGCAGGAGAACGTTTAA