SecReT6
Protein ID: 26249221
SecReT6 ID37
T6SS typei2
Gene symbol-
Locus tagc3386
StrainEscherichia coli CFT073
Repliconchromosome [GenBank: NC_004431] [Browse all T6SS(s) in this replicon]
Location [Strand]3223576..3225120 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ8FED9
KEGG IDecc:c3386
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.40E-173, Aligned region: 90..510
Protein Sequence: 514 a.a.     [Download]
>gi|26249221|ref|NP_755261.1| hypothetical protein c3386 [Escherichia coli CFT073]
MLMSVQQEHATSETATLTTTESGGVYQSLFDKINLTPVSSIQEIDLWQNSETLADASPDERVTAAIHVLL
SCLAKSGEDVVKLDKSLLDFHIDDLDQKISKQLDAVMHHPEFQKVESLWRGTWFVVQRTDFRKNVRIELL
DISKEHLRQDFDDSPEIIQSGLYRHTYIQEYDTPGGEPVASLISSYEFDNSPQDIALLRNISRVSAASHM
PFIGSVGPKFFLKNSMEEVAAIKDIGNYFDRAEYIKWKSFRDTDDSRYVGLVMPRVLGRLPYGPDTVPVR
SFNYVEEVKGPDHEKYLWTNASFAFAANMVKSFVNNGWCVQIRGPQAGGAVADLPIHLYDLGTGNQVKIP
SEVMIPETREFEFANLGFIPLSYYKNRDYACFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAH
YLKIIQRENIGTTKDRRVLELELNTWIRTLVTEMTDPGDELQASHPLRDGKVIVEDIEDNPGFFRVRLFA
VPHFQIEGMDVNLSLVSQMPKAKA
 
Nucleotide Sequence: 1545 bp     [Download]
>gi|26245917|ref|NC_004431.1|:3223576-3225120 Escherichia coli CFT073 chromosome, complete genome
ATGCTGATGTCTGTACAACAAGAACATGCCACCTCTGAAACTGCAACACTCACCACCACTGAGTCCGGCG
GCGTTTATCAGTCCCTGTTCGATAAAATTAATTTAACCCCGGTGTCTTCCATTCAGGAAATCGATTTATG
GCAAAACAGCGAAACGCTGGCCGATGCCTCACCCGATGAGCGCGTGACGGCGGCGATTCACGTTCTGCTT
TCCTGTCTGGCGAAATCAGGCGAGGACGTGGTTAAGCTCGACAAGAGCCTGCTGGATTTTCATATCGACG
ATCTGGATCAGAAAATCAGTAAACAGCTTGATGCGGTCATGCACCACCCTGAATTCCAGAAAGTCGAGTC
GCTGTGGCGTGGTACATGGTTCGTCGTACAGCGCACTGATTTTCGCAAAAATGTCAGAATTGAATTGCTG
GATATCAGCAAAGAGCATCTGCGTCAGGATTTTGATGATTCACCGGAAATCATTCAGAGTGGTTTATATC
GCCATACATACATTCAGGAGTACGATACGCCGGGTGGCGAACCTGTAGCCTCATTAATATCCAGCTATGA
ATTTGATAACAGCCCGCAGGATATTGCCCTGCTGCGTAATATTTCCAGAGTGTCTGCCGCTTCCCATATG
CCTTTTATCGGTTCTGTCGGACCGAAATTCTTCCTTAAAAATTCGATGGAAGAAGTCGCCGCGATTAAAG
ATATCGGCAACTACTTTGACCGCGCAGAATATATTAAATGGAAGTCGTTCCGCGATACGGATGACAGCCG
CTATGTGGGATTAGTGATGCCGCGCGTGCTGGGCCGTCTGCCCTATGGGCCGGACACGGTGCCGGTACGC
AGCTTTAACTATGTGGAAGAAGTCAAAGGCCCGGATCACGAAAAATACCTGTGGACAAACGCCTCGTTCG
CCTTTGCCGCCAATATGGTGAAGAGCTTTGTGAATAATGGCTGGTGCGTGCAGATCCGTGGCCCACAGGC
GGGCGGCGCAGTGGCCGATCTGCCGATCCATCTTTACGATCTCGGCACCGGCAATCAGGTCAAAATTCCG
TCCGAAGTGATGATCCCGGAAACCCGCGAGTTTGAGTTCGCCAACCTTGGCTTTATTCCACTCTCTTATT
ACAAAAACCGCGATTACGCCTGCTTTTTCTCGGCAAACTCCGCCCAGAAACCGGCGCTGTATGATACCGC
TGACGCCACCGCCAACAGCCGTATCAACGCCCGTTTGCCCTATATCTTCCTGCTGTCCCGCATTGCTCAC
TACCTGAAAATTATTCAGCGCGAGAATATCGGCACCACCAAAGACCGCCGCGTGCTGGAACTGGAGCTTA
ACACCTGGATCCGCACGCTGGTGACGGAAATGACCGATCCGGGCGATGAACTTCAGGCTTCGCATCCACT
GCGCGACGGGAAAGTTATCGTCGAGGACATAGAGGACAATCCGGGCTTTTTCCGCGTCAGACTCTTTGCC
GTGCCGCATTTCCAGATCGAAGGGATGGACGTCAACCTTTCTCTGGTTTCCCAGATGCCAAAAGCAAAAG
CCTGA