SecReT6
Protein ID: 26249222
SecReT6 ID37
T6SS typei2
Gene symbol-
Locus tagc3387
StrainEscherichia coli CFT073
Repliconchromosome [GenBank: NC_004431] [Browse all T6SS(s) in this replicon]
Location [Strand]3225140..3226477 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ8FED8
KEGG IDecc:c3387
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 9.70E-132, Aligned region: 18..442
Protein Sequence: 445 a.a.     [Download]
>gi|26249222|ref|NP_755262.1| hypothetical protein c3387 [Escherichia coli CFT073]
MKICRPLWAEGTFLSSQQFQQQARWEAFSNDSIAQLCIRHPWGIANVLFDRDALALGKLKTQAVRLRFAD
GTLIDSDVSDVLPLACDLRALKNDSAIVLLALPLAHGNGGNLGQGEQTERPLRYRQEWQKVQDIYGSDSE
DMAVERHALSLRFAHDNNQDYITCPLARLVRDVQGNWTQDESYIPPLLAFNAHDGLVQRLDTLLLQLRAK
CQRLMAMRRESNQRMADFAVADVSLFWLLNALNSAEPVLSDFLRYPAVHPELVWRELARLAGALLTFSLE
HNVSAVPPYVHESPSIVFPPLFSLLSELLEASLPSRVIALDLASLPGNRWKADLHDPRLREEADFYLSVR
SSLPAHQVLHQLPLVCKIGAPDDVTLLINVALNGVPLVPLTSVPAALPLRLENQYFALDMHSDAAKSMLE
SGCCMIYAPGTMGDLKPELFAVLRT
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|26245917|ref|NC_004431.1|:3225140-3226477 Escherichia coli CFT073 chromosome, complete genome
ATGAAAATTTGTCGACCACTGTGGGCTGAGGGGACATTCCTGTCTTCTCAGCAGTTTCAGCAGCAGGCCC
GCTGGGAAGCGTTCAGCAATGACAGCATTGCGCAGCTTTGTATTCGCCATCCGTGGGGGATCGCAAACGT
GCTCTTTGACCGGGATGCCCTGGCGCTCGGAAAGCTGAAAACGCAGGCAGTACGCCTGCGTTTTGCTGAT
GGTACGCTGATCGATTCAGACGTGAGTGACGTTCTGCCGCTCGCCTGCGATCTGCGCGCGCTGAAGAACG
ACAGCGCGATTGTCCTGCTGGCGCTGCCGCTTGCACATGGTAACGGCGGTAATCTCGGTCAGGGTGAGCA
GACTGAAAGACCGCTGCGCTATCGTCAGGAATGGCAAAAGGTGCAGGATATCTACGGCAGTGACAGTGAA
GATATGGCCGTTGAGCGTCATGCGCTGTCCCTGCGCTTTGCTCATGATAACAATCAGGATTACATCACCT
GCCCACTGGCGCGTCTGGTGCGGGATGTTCAGGGCAACTGGACACAGGATGAGAGCTATATTCCGCCGTT
ACTGGCGTTTAACGCCCATGACGGGCTGGTACAGCGTCTGGACACGCTGCTGTTGCAGCTACGGGCCAAA
TGTCAGCGCCTGATGGCGATGCGCCGGGAAAGCAACCAGCGTATGGCGGACTTCGCCGTCGCCGATGTCT
CCCTGTTCTGGCTGCTTAACGCGCTGAACTCCGCCGAGCCGGTACTGAGTGATTTCCTGCGCTACCCGGC
GGTTCATCCCGAACTGGTCTGGCGGGAGCTGGCGAGGCTTGCCGGTGCGCTGCTGACGTTTTCCCTTGAA
CATAACGTCAGCGCCGTTCCGCCCTATGTCCACGAATCGCCGTCCATCGTCTTTCCGCCACTTTTCTCCC
TGCTCAGCGAACTGCTGGAAGCCAGCCTGCCGTCACGGGTGATCGCGCTGGATCTGGCGTCCCTGCCGGG
CAACCGCTGGAAAGCAGACCTGCACGATCCGCGCCTGCGGGAAGAGGCCGACTTTTACCTGTCCGTTCGT
TCCTCTCTGCCTGCGCATCAGGTACTGCACCAGCTACCGCTGGTCTGCAAAATCGGTGCGCCTGATGACG
TCACGCTGCTTATCAATGTGGCGCTGAATGGTGTTCCACTGGTGCCGCTTACCTCAGTTCCGGCAGCGCT
GCCACTGCGGCTGGAGAACCAGTATTTTGCGCTGGATATGCACAGTGACGCGGCTAAATCGATGCTGGAG
TCCGGGTGCTGCATGATTTATGCGCCGGGAACAATGGGCGACCTGAAACCTGAACTGTTTGCGGTGCTGC
GCACATGA